KEGG   Ursus maritimus (polar bear): 103664043
Entry
103664043         CDS       T03271                                 

Gene name
RUNX2
Definition
(RefSeq) runt related transcription factor 2
  KO
K09278  runt-related transcription factor 2
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    103664043 (RUNX2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    103664043 (RUNX2)
Transcription factors [BR:umr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    103664043 (RUNX2)
SSDB
Motif
Pfam: Runt RunxI
Other DBs
NCBI-GeneID: 103664043
NCBI-ProteinID: XP_008690068
UniProt: A0A384C5F0
LinkDB
Position
Un
AA seq 408 aa
MEGAVSQTGPRALPGRRFRPCLASELVKVVALGEVPDGTVVTVMAGNDENYSAELRNASA
VMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQK
LDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQS
SPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWP
STLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMS
ATTHYHTYLPPPYPGSSQNQSGPFQTSSTPYLYYGTSSGSYQFPMVPGGDRSPSRMLPPC
TTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggagggggcggtgagccagacagggccaagagcactcccgggaagacgcttccggccc
tgtctagcctctgaacttgtgaaggtggtagccctcggagaggtaccagatgggactgtg
gttactgtcatggcgggtaacgatgaaaattattctgctgagctccgaaatgcctctgct
gttatgaaaaaccaagtagcaaggttcaacgatttgagatttgtgggccggagtggaaga
ggcaagagtttcaccttgaccataactgtcttcacaaatcctccccaagtagccacctat
cacagagctattaaagttaccgtggacggaccccgggaacccagaaggcacagacagaag
cttgatgactctaaacctagtttgttctctgaccgcctcagtgatttagggcgcattcct
catcccagtatgagagtaggtgtcccgcctcagaacccacggccctccctgaactctgca
ccaagtccttttaatccacaaggacagagtcagattacagaccccaggcaggcacagtct
tccccgccgtggtcctatgaccagtcttacccctcctacctgagccagatgacgtccccg
tccattcactccaccaccccgctgtcttccacacggggcacggggcttcctgccatcacc
gacgtgcccaggcgcatttcagatgatgacactgccacctctgacttctgcctctggcct
tccactctcagtaagaagagccaggcaggtgcttcagaactgggccctttttcagacccc
aggcagttcccaagcatttcatccctcactgagagccgcttctccaacccacgaatgcac
tatccagccacctttacttacaccccgccagtcacctcaggcatgtccctcggtatgtcc
gccaccacccactaccacacctacctgccaccaccctaccccggctcttcccaaaaccag
agtggacccttccagaccagcagcactccatatctctactatggcacttcgtcaggatcc
tatcagttccccatggtgccggggggagatcggtctccttccagaatgcttccgccatgc
accaccacctcgaatggcagcacgctattaaatccaaatttgcctaaccagaatgatggt
gttgacgctgatggaagccacagcagttccccaaccgttttgaattctagtggcagaatg
gatgaatctgtttggcgaccatattga

DBGET integrated database retrieval system