KEGG   Ursus maritimus (polar bear): 103664305
Entry
103664305         CDS       T03271                                 

Gene name
SMAD4
Definition
(RefSeq) SMAD family member 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04068  FoxO signaling pathway
umr04110  Cell cycle
umr04310  Wnt signaling pathway
umr04350  TGF-beta signaling pathway
umr04371  Apelin signaling pathway
umr04390  Hippo signaling pathway
umr04520  Adherens junction
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04659  Th17 cell differentiation
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr05161  Hepatitis B
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05220  Chronic myeloid leukemia
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103664305 (SMAD4)
   04350 TGF-beta signaling pathway
    103664305 (SMAD4)
   04390 Hippo signaling pathway
    103664305 (SMAD4)
   04371 Apelin signaling pathway
    103664305 (SMAD4)
   04068 FoxO signaling pathway
    103664305 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103664305 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103664305 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    103664305 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103664305 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103664305 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103664305 (SMAD4)
   05212 Pancreatic cancer
    103664305 (SMAD4)
   05225 Hepatocellular carcinoma
    103664305 (SMAD4)
   05226 Gastric cancer
    103664305 (SMAD4)
   05220 Chronic myeloid leukemia
    103664305 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103664305 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103664305 (SMAD4)
   05161 Hepatitis B
    103664305 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1
Other DBs
NCBI-GeneID: 103664305
NCBI-ProteinID: XP_008690383
UniProt: A0A384C6C3
LinkDB
Position
Un
AA seq 546 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRSAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAPDIPGPGSVGGIAPAISLSA
AAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIA
DPQPLD
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacaaacacaccaacaagtaatgatgcctgtctgagcattgta
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaaactgaaggagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagcgcatcctagcaaatgtgttaccatacagagaacattggatggg
aggcttcaggtggccggtcggaaaggatttcctcatgtgatctatgcccgtctctggagg
tggcctgatcttcataaaaatgaactcaaacatgttaaatattgtcagtatgcattcgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccaccaagtatgttggtgaaggat
gaatatgttcatgactttgagggacagccatcattatccactgaagggcattcaattcaa
accatccagcatccaccaagtaatcgtgcctcaacggagacatacagcaccccagctctg
ttagctccatctgagtctaatgctaccagcaccaccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggcgggcagccatagtgaaggattgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtaggagcgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggccagttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct
gagtattggtgttccatcgcttactttgaaatggatgttcaagtaggagagacatttaag
gttccttcaagctgccctattgttactgttgatggatatgtggacccttctggaggagat
cgcttttgcttgggtcaactctccaatgttcacaggacagaagccattgagagagcaagg
ttgcacataggcaaaggtgtacagttggaatgtaaaggtgaaggtgatgtttgggtcagg
tgccttagcgaccatgcagtctttgtgcagagttactacttagacagagaagctgggcgt
gcacctggagatgctgttcataagatctacccaagtgcatacataaaggtctttgacttg
cgtcagtgtcaccgtcagatgcagcagcaggcggccaccgcgcaggccgcagccgccgcc
ccggacatccccggccccggatcagtaggtggaatagctccagccatcagtttgtcggcg
gctgccggcattggcgttgatgaccttcgtcgcttgtgcatactcaggatgagtttcgtg
aaaggctggggaccggattacccaagacagagcatcaaagaaacgccttgctggatcgag
attcacttacaccgggccctccagctcttagatgaagtgcttcacaccatgcctattgct
gacccacagcctttagactga

DBGET integrated database retrieval system