KEGG   Ursus maritimus (polar bear): 103664318
Entry
103664318         CDS       T03271                                 

Gene name
FLT3
Definition
(RefSeq) fms related tyrosine kinase 3
  KO
K05092  fms-related tyrosine kinase 3 [EC:2.7.10.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04640  Hematopoietic cell lineage
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05221  Acute myeloid leukemia
umr05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103664318 (FLT3)
   04014 Ras signaling pathway
    103664318 (FLT3)
   04151 PI3K-Akt signaling pathway
    103664318 (FLT3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103664318 (FLT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103664318 (FLT3)
   05202 Transcriptional misregulation in cancer
    103664318 (FLT3)
   05230 Central carbon metabolism in cancer
    103664318 (FLT3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103664318 (FLT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103664318 (FLT3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:umr04090]
    103664318 (FLT3)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103664318 (FLT3)
Protein kinases [BR:umr01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103664318 (FLT3)
CD molecules [BR:umr04090]
 Proteins
  103664318 (FLT3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 Ig_2 APH
Other DBs
NCBI-GeneID: 103664318
NCBI-ProteinID: XP_008690404
UniProt: A0A384C7G0
LinkDB
Position
Un
AA seq 974 aa
MTFETITNQDLPVIKCVLINHKNNDSSLGISSSYPMASGPPEDLGCALKPESTQAVYGAA
TVEVDMLASITLQVLVNTPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAG
EYLLFIQSEATNYTILFTVSIRSTLLYTLRRPFFRKMENQDALVCISESIPEPTVEWVFC
DSQSESCKGESPAVVTKEGSVLHELFGTDIRCCARNELGRECTKLFTIDLNQTPQTTPPQ
LFLKVGEPLWIRCKAVHVNHGFGLSWELENKALEEGRYFEMSTYSTNRTMIRVLFAFVTS
VGRNDTGYYTCSSSEHPSKSALVTILEKGFINASKSNEDYEIDQYEEFCFSVRFKAYPQI
RCTWTFSRKSFPCEQSGLDDGYSISKFCNHKHQPGEYIFHAENDDAEFTKMFTLNIRRKP
QVLAETSASQASCSSDGYPLPSWTWKKCSDKSSNCTEEITEGIWNIKANRKVFGQWISSS
TLNMSEAMKGFLVKCCAYNSLGTSCETILLNSSGPFPFIQDNISFYATVGLCLPFIAILT
MLICHKYKKQFRYESQLQMVQVTGSLDNEYFYIDFREYEYDLKWEFPRENLEFGKVLGSG
AFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMSELKMMTHLGNHENIVNLLG
ACTLSGPIYLIFEYCCYGDLLNYLRNKREKFHRTWTEIFKEHNFSFYPTFQSQPNSSMPG
SREVQIHQDLDHISGFNGNSFQSEDETEYENQKRLEEEEDLNVLTFEDLLCFAYQVAKGM
EFLEFKSCVHRDLAARNVLVTHGKGVKICDFGLARDIRSDSNYVVRGNARLPVKWMAPES
LFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYKLIQSGFKMDQPFYATEEIY
FIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNTDGHVSDRPSGYQNRRPYSREV
DSGLLAPQGHGEDS
NT seq 2925 nt   +upstreamnt  +downstreamnt
atgacatttgagactattacaaatcaagatctgcctgtgatcaagtgtgttttaatcaat
cataagaacaatgattcatcactggggatatcatcatcgtatcccatggcatcaggaccc
ccagaagacctcgggtgtgccttgaagcctgagagcacacaggcggtctatggagcagcc
actgtggaagtggacatgttggcatccatcacactccaagtactggtcaacaccccgggg
aacatttcctgtctctgggtctttaaacacagctccctgaattgccagccccactttgat
ttacagaacagaggagttgtttccatggtcattttgaaaatgacagaaacccaagctgga
gaatacctacttttcattcagagtgaagctaccaattacacaatactgtttacagtgagt
ataagaagtacactgctttacacattaaggagacctttcttcagaaaaatggaaaatcag
gacgccctggtctgcatatctgagagcattccagaaccgaccgtggaatgggtgttctgc
gattcacagagtgaaagctgtaaaggggagagtcccgctgttgttacaaaggagggaagt
gtgcttcatgagctgtttggaacagacataaggtgctgtgcaagaaacgagctgggcagg
gagtgtaccaagctgttcacaatagatctaaatcagacgcctcagaccacaccgccacag
ttatttctgaaagtaggggaacccttgtggataaggtgcaaagccgttcatgtaaaccac
ggattcggactcagctgggagctagaaaataaagccctggaagagggccgctactttgag
atgagtacctactccacaaacagaactatgatacgggtcctgtttgctttcgtaacatcc
gtgggaaggaacgacaccggctattacacctgttcctcctcagagcatcccagtaaatca
gctttggttaccatcctagaaaagggatttataaacgcttccaaatcaaatgaagattat
gagattgaccagtatgaagagttttgtttttctgtcaggtttaaagcgtacccacaaatc
agatgtacatggaccttctctcgaaaatcgtttccttgtgagcagagtggccttgatgat
gggtacagcatatctaagttttgcaaccataaacaccagccaggagaatatatattccat
gcagaaaatgatgatgccgaattcacaaaaatgttcacgctgaacataagaaggaaacct
caggtgctagccgagacgtcagcaagtcaggcttcgtgttcctctgacggctacccctta
ccatcttggacctggaagaagtgttcagacaagtcttccaactgcacagaggagatcaca
gaaggaatttggaatataaaggctaacagaaaagtgttcggccagtggatatcgagcagc
acccttaacatgagtgaggccatgaagggattcctggtgaagtgctgtgcctacaattcc
cttggcacatcttgtgaaacaatccttttaaactcgtcagggcccttccctttcatccaa
gacaacatctccttctatgcaacagtcgggctttgtcttcccttcattgccattctaacc
atgctaatttgtcacaagtacaaaaagcaatttaggtatgagagccagctgcaaatggtg
caggtgaccggctctttggataatgagtacttctacattgatttcagagaatatgaatat
gatctcaaatgggagtttccaagagaaaatttagaatttgggaaagtactaggatcgggt
gctttcggaaaagtgatgaatgcaacagcttatggaattagtaaaacaggagtctcaatc
caggtggcagtcaaaatgctgaaagaaaaggcagacagttctgaaagagaggctctcatg
tctgaactcaaaatgatgactcacctgggaaaccacgagaatatcgtgaatctgctgggg
gcatgcacactgtcaggaccaatttacttgatttttgaatattgttgctatggtgatctt
ctcaactatctaagaaataaaagagaaaaatttcacaggacatggacagagattttcaag
gaacacaatttcagtttttaccccactttccaatcacaaccaaattccagtatgcctggt
tcaagagaagttcagatacaccaggacttggatcatatctcagggttcaatgggaattca
tttcaatccgaagatgaaactgaatatgaaaaccaaaaaaggctggaggaagaagaggac
ttgaatgtgctgacatttgaagaccttctttgctttgcctaccaagttgccaaaggaatg
gaatttctggaatttaagtcgtgtgttcacagagacctggcagccaggaacgtgctcgtg
acccacgggaaaggggtgaagatctgcgatttcggactggcccgggatatcaggagtgac
tccaactatgttgtcaggggcaacgctcgtctgcccgtaaagtggatggcccctgagagc
ttatttgaggggatctacaccataaagagtgacgtctggtcgtatggaatattactctgg
gaaatattctcgcttggtgtcaatccgtaccctggtattccggttgatgctaatttctat
aaactcattcaaagcggatttaagatggatcagccgttttatgctacggaagaaatatac
tttataatgcaatcctgctgggcttttgactcaaggaaacggccgtccttccccaatcta
acttcatttttgggatgtcagctggcagacgccgaagaagcgatgtatcagaacacggat
ggccacgtctcagaccgtccttccggctaccagaacaggcgaccttacagtagagaggtg
gattccgggctcctggctccccagggtcatggtgaagactcctag

DBGET integrated database retrieval system