KEGG   Ursus maritimus (polar bear): 103664413
Entry
103664413         CDS       T03271                                 

Gene name
B3GLCT, B3GALTL
Definition
(RefSeq) beta 3-glucosyltransferase
  KO
K13675  UDP-glucose:O-linked fucose beta-1,3-glucosyltransferase [EC:2.4.1.-]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    103664413 (B3GLCT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103664413 (B3GLCT)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     103664413 (B3GLCT)
Glycosyltransferases [BR:umr01003]
 Glycan extension
  O-Glycan
   103664413 (B3GLCT)
SSDB
Motif
Pfam: Fringe Galactosyl_T DUF604 Glycos_transf_2
Other DBs
NCBI-GeneID: 103664413
NCBI-ProteinID: XP_008690516
UniProt: A0A384C6J2
LinkDB
Position
Un
AA seq 509 aa
MEEVVCCFLLPRETYRRNPLYYITASWNRLSGTFSFALVSEDIKKEVKQSKNLEKSGVSR
KSDIDLKGIVFVIQSQSNSFHAKRAEQLQKSILKQAANLTQELPRVLLLHQLSKQEGAWT
ILPLLPHFSVTYSRNSSWIFFCEEETRIQIPELLETLRRYDPSKEWFLGKALHDEESTII
HHYAFSENPTIFKYPDFAAGWALSIPLVNKLTKRLKSESLKSDFTIDLKHEIALYIWDKG
DGPPLTPVPEFCTEAVDSSCATTFHSFLPLCGNPVKKEDIFFAVKTCKKFHGDRIPIVKQ
TWAGQASVIEYYSDHAESSIPTVDLGVPNTDRGHCGKTFAILEKFLNHSHDKIAWLVIVD
DDTLISISRLQHLLSCYDSSEPVFLGERYGYGLGTGGYSYITGGGGMVFSREAIRRLLAS
KCRCYSNDAPDDMVLGMCFSGLGIPVTHSPLFHQARPVDYPRDYLSHQVPISFHKHWNID
PVKVYFTWLAPREEDKARQETHKGFKEEL
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggaggaggtcgtctgctgcttcctgttaccgcgggagacttaccgccgaaaccccttg
tactacattaccgcctcgtggaatcggctgtccggcactttttcttttgctttggtttct
gaagatataaagaaagaggtcaagcaatctaagaatttggagaaaagtggtgtctcaagg
aaaagtgacatagatttaaaaggaattgtatttgtcatccagagtcaaagtaattctttt
catgcaaagagagcagaacagttacaaaaaagcatcttaaagcaagcggcaaatcttaca
caggaactccccagagtccttcttcttcaccagctgtctaagcaggaaggtgcatggacc
atacttccattgttaccacacttttctgtaacatatagcagaaattcatcgtggattttc
ttctgtgaagaggagacaagaatacaaattccagaactcttagaaacactcagaagatat
gacccatcaaaggaatggtttttaggaaaagcattacatgatgaagaatctacaataatt
caccattatgccttttctgaaaatcctacgatttttaaatatccagactttgctgctggc
tgggcccttagtattccacttgtaaacaagcttaccaagaggttaaagagtgaatccctg
aaatccgactttacgatagatttaaaacatgagattgccctctacatctgggacaaaggc
gatgggcctcccctcactccagtgcctgagttttgtacagaggctgtggactcttcttgt
gctaccacattccattcttttctaccactttgtggaaatccagtgaagaaagaggatata
ttttttgcagtaaaaacatgcaagaaatttcatggtgatagaattcccattgtaaagcag
acctgggcaggccaggcaagtgtcattgaatactacagtgatcacgcagaaagttccatc
cctacagtagatctgggggttcccaatacagatagaggtcattgtggaaagacatttgcc
attttggaaaaatttctgaatcacagccatgacaaaatagcatggttggtcattgtggat
gacgatacattaataagcatctccaggctccagcacttgcttagctgttatgactccagc
gaaccggtgtttctgggagagcggtacggctatggcctgggcactggcggctacagctac
atcacaggaggaggaggaatggtcttcagcagagaagcaatcaggagacttctcgccagt
aaatgccgctgctacagcaacgatgctcccgacgacatggtcctaggaatgtgctttagt
gggctgggaatccctgtgacacacagccctctcttccatcaggctcggcccgtggattat
cccagggactacctttctcaccaagtccccatctcctttcacaaacactggaacatcgat
ccagtaaaggtgtatttcacgtggttggcacccagggaggaagacaaagccaggcaggag
acacacaaaggctttaaggaagaattataa

DBGET integrated database retrieval system