KEGG   Ursus maritimus (polar bear): 103665227Help
Entry
103665227         CDS       T03271                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00500  Starch and sucrose metabolism
umr01100  Metabolic pathways
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04910  Insulin signaling pathway
umr04922  Glucagon signaling pathway
umr04931  Insulin resistance
Module
umr_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103665227 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103665227 (GYS2)
   04152 AMPK signaling pathway
    103665227 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103665227 (GYS2)
   04922 Glucagon signaling pathway
    103665227 (GYS2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    103665227 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103665227 (GYS2)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     103665227 (GYS2)
Glycosyltransferases [BR:umr01003]
 Polysaccharide
  Storage polysaccharide
   103665227 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 GAPES3
Motif
Other DBs
NCBI-GeneID: 103665227
NCBI-ProteinID: XP_008691335
UniProt: A0A384CAA1
LinkDB All DBs
Position
Un
AA seq 703 aa AA seqDB search
MLRGRSLSVTSLSGLPQWEVEELPIEDLLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWG
DNYFLIGPYFEHNLKTQVEQCEPVNDAVRRAMDSMNKHGCQVHFGRWLIEGSPYVVLFDI
GYSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFLKEVTDNADGKHVIAQFH
EWQAGTGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLEALSRLNFLLRVHKSDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDIAHSVKEKFGKKLYDALLRGEIPDMDNIL
DRDDITIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNSRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARYLTLSRAFPDKFHMEPTSPPTTEGFKYPRPSSVPPSPSGSQVSSPQSSDVE
DEEEDERYNEEEEAERDRLNIKSPFSPGRVPRGKKKLHGEYKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaggccgatctctatcagtgacatccctgagcgggcttcctcagtgggaagtt
gaagaacttcccatagaggatttactgctctttgaagttgcttgggaagtaaccaataaa
gttggtggcatctatactgtgattcagacgaaggccaaaaccacagcagatgaatgggga
gacaattattttctgattggcccatattttgagcataatttgaagactcaggtggaacag
tgtgaacctgtaaatgatgctgttagaagagcaatggactcaatgaataaacatggctgc
caggtgcactttggaagatggctgatagaggggagtccttacgtggtgctttttgacata
ggctattcggcttggaacctggaccggtggaagggtgacctctgggaagcgtgcagtgtc
ggcatcccttatcatgaccgagaagccaacgacatgctaatattcggatctttaactgcc
tggttcttaaaagaggtgacagataatgcagatgggaagcatgtcattgcccaattccat
gaatggcaggcgggaactggactgatcctttctcgagctcggaaacttcccatcgctacc
atatttaccactcacgccacactgcttgggaggtatctctgtgcggcaaacatcgatttc
tacaaccatcttgataagtttaacatagacaaagaggctggggaaaggcagatttaccac
cggtactgcatggagcgggcctctgtccattgtgctcatgtgttcaccacagtatccgaa
ataacagcaatagaagccgagcatatgctgaagaggaagcctgatgtagttactccaaat
ggcttgaacgttaagaaattttcagcggtgcatgagtttcaaaatctacatgccatgtac
aaggccaggatccaagattttgttcgaggtcatttctatggtcatctggactttgatctt
gaaaagactttgttccttttcattgctgggagatacgagttttcgaacaaaggagcggac
atcttcctagaagccttatccaggctaaattttctgctgagggtgcataaaagtgacgtc
acagtggtggtgtttttcatcatgcctgccaagacaaataatttcaatgtggaaacgctg
aaaggccaggcagtgcggaaacagctatgggacatagcacattctgtgaaggaaaaattt
gggaagaaactctatgatgcattgttaagaggagaaattcctgacatggacaatattttg
gatcgagatgatataacaattatgaaaagagccatcttttcaactcagcgacagtctctg
cctcctgtgaccactcacaacatgattgatgactccactgatcccatcctcagcaccatt
agacggatcggacttttcaacagccgcacggacagagtcaaggtgattttgcacccagag
tttctatcctccaccagccccttattacccatggattatgaagagtttgtccgaggttgt
catcttggagtatttccatcatactatgaaccgtggggttatactccggctgaatgcact
gtgatgggtatccccagtgtgacaaccaacctttccggctttggctgtttcatgcaggag
cacgtggctgatcctactgcttacggtatttacattgttgacaggcggttccgttctcca
gatgattcctgcaatcagctgactcagtttctctatggattttgcaaacagtcacgccgc
caaagaattattcagagaaaccgaactgagaggctctccgatcttctggattggagatac
ttgggcagatattatcaacacgccaggtacctgacgttaagcagagcttttccagataaa
ttccatatggagcctacatcaccacccacgacagaaggatttaaataccccaggccttcc
tcagttccaccttccccttcagggtctcaggtctctagtcctcaaagcagtgatgtggaa
gatgaagaagaggatgagcggtacaatgaggaagaggaggctgaaagggatcggttaaat
atcaagtcgccattttctccgggccgtgttcctcgtgggaagaaaaagctgcatggtgaa
tacaagaactga

DBGET integrated database retrieval system