KEGG   Ursus maritimus (polar bear): 103665275
Entry
103665275         CDS       T03271                                 

Gene name
ITPR2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04070  Phosphatidylinositol signaling system
umr04114  Oocyte meiosis
umr04210  Apoptosis
umr04218  Cellular senescence
umr04270  Vascular smooth muscle contraction
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04621  NOD-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04720  Long-term potentiation
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04728  Dopaminergic synapse
umr04730  Long-term depression
umr04750  Inflammatory mediator regulation of TRP channels
umr04912  GnRH signaling pathway
umr04915  Estrogen signaling pathway
umr04918  Thyroid hormone synthesis
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04924  Renin secretion
umr04925  Aldosterone synthesis and secretion
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04929  GnRH secretion
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr05010  Alzheimer disease
umr05012  Parkinson disease
umr05017  Spinocerebellar ataxia
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05163  Human cytomegalovirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103665275 (ITPR2)
   04020 Calcium signaling pathway
    103665275 (ITPR2)
   04070 Phosphatidylinositol signaling system
    103665275 (ITPR2)
   04022 cGMP-PKG signaling pathway
    103665275 (ITPR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103665275 (ITPR2)
   04210 Apoptosis
    103665275 (ITPR2)
   04218 Cellular senescence
    103665275 (ITPR2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103665275 (ITPR2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103665275 (ITPR2)
   04621 NOD-like receptor signaling pathway
    103665275 (ITPR2)
   04625 C-type lectin receptor signaling pathway
    103665275 (ITPR2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103665275 (ITPR2)
   04929 GnRH secretion
    103665275 (ITPR2)
   04912 GnRH signaling pathway
    103665275 (ITPR2)
   04915 Estrogen signaling pathway
    103665275 (ITPR2)
   04921 Oxytocin signaling pathway
    103665275 (ITPR2)
   04935 Growth hormone synthesis, secretion and action
    103665275 (ITPR2)
   04918 Thyroid hormone synthesis
    103665275 (ITPR2)
   04928 Parathyroid hormone synthesis, secretion and action
    103665275 (ITPR2)
   04924 Renin secretion
    103665275 (ITPR2)
   04925 Aldosterone synthesis and secretion
    103665275 (ITPR2)
   04927 Cortisol synthesis and secretion
    103665275 (ITPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103665275 (ITPR2)
  09154 Digestive system
   04970 Salivary secretion
    103665275 (ITPR2)
   04971 Gastric acid secretion
    103665275 (ITPR2)
   04972 Pancreatic secretion
    103665275 (ITPR2)
  09156 Nervous system
   04724 Glutamatergic synapse
    103665275 (ITPR2)
   04725 Cholinergic synapse
    103665275 (ITPR2)
   04728 Dopaminergic synapse
    103665275 (ITPR2)
   04726 Serotonergic synapse
    103665275 (ITPR2)
   04720 Long-term potentiation
    103665275 (ITPR2)
   04730 Long-term depression
    103665275 (ITPR2)
   04723 Retrograde endocannabinoid signaling
    103665275 (ITPR2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103665275 (ITPR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103665275 (ITPR2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103665275 (ITPR2)
   05012 Parkinson disease
    103665275 (ITPR2)
   05017 Spinocerebellar ataxia
    103665275 (ITPR2)
   05020 Prion disease
    103665275 (ITPR2)
   05022 Pathways of neurodegeneration - multiple diseases
    103665275 (ITPR2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103665275 (ITPR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103665275 (ITPR2)
   05163 Human cytomegalovirus infection
    103665275 (ITPR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103665275 (ITPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:umr04040]
    103665275 (ITPR2)
Ion channels [BR:umr04040]
 Ligand-gated channels
  IP3 receptor
   103665275 (ITPR2)
SSDB
Motif
Pfam: RYDR_ITPR Ins145_P3_rec MIR RIH_assoc Ion_trans DUF2207 Sec2p
Other DBs
NCBI-GeneID: 103665275
NCBI-ProteinID: XP_008691391
UniProt: A0A384C927
LinkDB
Position
Un
AA seq 2672 aa
MRLVDDRCVVHPEAGDLANPPKKFRDCLFKVCPMNRYSAQKQYWKAKQAKQGNHTEAALL
KKLQHAAELEQKQNESENKKLLGEIVKYSNVIQLLHIKSNKYLTVNKRLPALLEKNAMRV
SLDAAGNEGSWFYIHPFWKLRSEGDNIVVGDKVVLMPVNAGQPLHASNIELLDNPGCKEV
NAVNCNTSWKITLFMKYSSYREDVLKGGDVVRLFHAEQEKFLTCDEYEKKQHIFLRTTLR
QSATSATSSKALWEIEVVHHDPCRGGAGQWNSLFRFKHLATGNYLAAELNPDYRDAQNEG
KNVRDGDLPTSKKKRQAGEKIMYTLVSVPHGNDIASLFELDATTLQRADCLVPRNSYVRL
RHLCTNTWVTSTSIPIDTDEERPVMLKIGTCQTKEDKEAFAIVSVPLSEVRDLDFANDAN
KVLATTVKKLENGTITQNERRFVTKLLEDLIFFVADVLNNGQEVLDVVISKPNRERQKLM
REQNILAQVFGILKAPFKEKAGEGSMLRLEDLGDQRYAPYKYMLRLCYRVLRHSQQDYRK
NQEYIAKNFCVMQSQIGYDILAEDTITALLHNNRKLLEKHITAKEIETFVSLLRRNREPR
FLDYLSDLCVSNTTAIPVTQELICKFMLSPGNADILIQTKLVSMQVDNPMESSILSDDID
DEEVWLYWIDSNKEPHGKAIRHLAQEAKEGTKADLEVLTYYRYQLNLFARMCLDRQYLAI
NQISTQLSVDLILRCVSDESLPFDLRASFCRLMLHMHVDRDPQESVVPVRYARLWTEIPT
KITIHEYDSITDSSRNDMKRKFALTMEFVEEYLKEVVNQPFPFGDKEKNKLTFEVVHLAR
NLIYFGFYSFSELLRLTRTLLAILDIVQAPMSSYFERLSKFQDGGNNVMRTIHGVGEMMT
QMVLSRGSIFPMSVPDVQPNIHPSKQGSPVEPEDVTVMDTKLKIIEILQFILSVRLDYRI
SYMLSIYKKEFGENNENSETSASGSPDTLLPSAIVPDIDEIASQAETMFAGRKEKNPVQL
DDEGGRTFLRVLIHLIMHDYPPLLSGALQLLFKHFSQRAEVLQAFKQVQLLVSNQDVDNY
KQIKADLDQLRLTVEKSELWVEKSSSYENGELGESQVKGGEEPIEESSILSPVQDGTRKP
QIDSNKSNNYRIVKEILIRLSKLCVQNKKCRNQHQRLLKNMGAHSVVLDLLKIPYEKNDE
KMNEVMNLAHTFLQNFCRGNPQNQVLLHKHLNLFLTPGLLEAETMRHIFMNNYHLCNEIS
ERVVQHFVHCIETHGRHVEYLRFLQTIVKADGKYVKKCQDMVMTELINGGEDVLIFYNDR
ASFPILLHMMCSERDRGDESGPLVYHITLVELLAACTEGKNVYTEIKCNSLLPLDDIVRV
VTHDDCIPEVKIAYVNFVNHCYVDTEVEMKEIYTSNHIWKLFENFLVDMARVCNTTTDRK
HADTSLEKCVTESIMSIVSGFFNSPFSDNSTSLQTHQPVFIQLLQSAFRIYNCTWPNPAQ
KSYVESCIRTLAEVAKNRGIAIPVDLDSQVNTLFLKSHSNMVQRAAMGWRLSARSGPRFK
EALGGPAWDYRNIIEKLQDVVASLEQQFSPMMQAEFSVLVDVLYSPELLFPEGSDARIRC
GAFMSKLINHTKKLMEKEEKLCIKILQTLREMLEKKDSFVEEGNTLRKILLNRYFKGDYG
VGMNGHLSGTYCKSAQGGGSFSGQDSDKMGISMSDIQCLLDKEGASELVIDVIVNTKNDR
IFSEGILLGIALLEGGNTQTQYSFYQQLHEQKKSEKFFKVLYDRMKAAQKEIRSTVTVNT
IDLGNKKRDDDNELMTSGPRMRVRDSSLLLKEGMKGQLTEASSATSKAYCAYRREMDPEI
DIMCAGSEVGNAEEKSAEEVTMSPAIAIMQPILRFLQLLCENHNRELQNFLRNQNNKTNY
NLVCETLQFLDCICGSTTGGLGLLGLYINEKNVVLVNQTLESLTEYCQGPCHENQTCIAT
HESNGIDIIIALILNDINPLGKYRMDLVLQLKNNASKLLLAIMESRHDSENAERILFNMR
PRELVDVMKNAYNQGLECDHGDDEGGDDGVSPKDVGHNIYILAHQLARHNKLLQQMLKPG
SDPDDGDEALKYYANHTAQIEIVRHDRTMEQIVFPVPNICEYLTRESKCRVFNTTERDEQ
GSKVNDFFQQTEDLYNEMKWQKKIRSNPALFWFSRHISLWGSISFNLAVFINLAVALFYP
FGDDGDEGTLSPLFSVLLWIAVAVCTSMLFFFSKPVGIRPFLVSIMLRSIYTIGLGPTLI
LLGAANLCNKIVFLVSFVGNRGTFTRGYRAVILDMAFLYHVAYVLVCMLGLFVHEFFYSF
LLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIIGFLFLKDDFTMEVDRLK
NRTPITGSNEVPTMTLTSTMETCQKDNCTPTIPASNTADEEYEDGIERTCDTLLMCIVTV
LNQGLRNGGGVGDVLRRPSKDEPLFAARVVYDLLFYFIVIIIVLNLIFGVIIDTFADLRS
EKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKSEHNMWHYLYFLVLVKVKDPTEYTG
PESYVAQMIVEKNLDWFPRMRAMSLVSNEGDSEQNEIRNLQEKLESTMSLVKQLSAQLAE
LKEQMTEQRKTKQRLGFLGPNTPHVNHHVPPH
NT seq 8019 nt   +upstreamnt  +downstreamnt
atgaggttagtggatgatagatgtgtggtgcacccggaggcaggagaccttgccaaccct
cccaagaagttcagagactgcctctttaaggtgtgccctatgaaccgatattctgcccag
aaacaatattggaaagctaagcaagccaaacaggggaaccacacagaggcagctttgctg
aagaaattacagcacgccgcagaactggagcaaaaacaaaatgaatcagagaataagaaa
ctgttgggagaaattgtgaaatacagtaatgtcatacaactactgcatataaaaagcaac
aagtatctgactgtcaacaagagattacctgctttactggagaagaatgccatgcgtgtg
tccttggatgctgcaggaaatgaagggtcttggttttatattcatcccttctggaagctg
agaagcgagggtgacaacattgtcgtgggtgataaagttgtcctgatgcccgtgaacgca
ggacagccgctgcatgccagcaacatagagcttctcgataatccagggtgcaaggaggtg
aatgccgttaattgcaacactagctggaaaatcactttattcatgaaatatagttcctat
cgagaggatgtactaaaaggaggtgatgttgttaggttgtttcatgcagaacaggagaag
tttctgacttgtgatgaatatgagaaaaaacagcacattttccttcggacaaccttgcgt
cagtcagccacttccgctaccagttctaaagcgctctgggaaatagaggtcgttcatcat
gacccgtgccgtggaggtgctgggcaatggaatagcttgttcagatttaaacaccttgca
actgggaactacttagctgcagagcttaatcctgattatcgagatgctcaaaatgaagga
aaaaacgtgagagatggagatcttccaacttcaaagaagaaacgccaggctggggagaag
atcatgtatactttagtctcagtcccacatggaaatgacattgcgtccctttttgaactg
gatgccacaactcttcagagagctgactgcctggttccaaggaactcatatgttcggttg
aggcatttgtgtaccaacacatgggtaacaagtactagcatccccatagacacagatgaa
gagagacctgttatgttgaagattggaacttgccagacaaaagaagataaagaagcattt
gccattgtgtctgtcccgttgtctgaggtccgagacttagactttgccaatgatgcaaat
aaagtgctggcgaccacagttaaaaagctggaaaatggtacaataactcagaatgaaagg
aggtttgtaaccaaattattggaagacctcatcttctttgtggctgatgtacttaataat
ggacaagaagttctggatgtggttatcagtaagccaaaccgagaacgtcaaaaattaatg
agggaacaaaacatattggcacaggtatttgggattcttaaagcaccctttaaggagaag
gcaggagaaggctcaatgctgagactcgaagatctgggggaccagagatacgctccctac
aagtatatgctgaggctgtgttaccgtgtgctgagacattcacagcaggactaccggaaa
aatcaggaatatattgctaagaatttctgtgtcatgcagtcccagattggctatgatatt
ttggcagaagatacgatcacagctttgttgcacaacaacagaaaactactagagaaacat
atcacagcaaaagaaatagaaacatttgtcagtttactcaggagaaatcgtgagccaagg
tttttggattatttatcggatctgtgcgtatctaataccaccgccatacccgtaactcag
gaactcatctgtaaatttatgttgagcccaggcaatgcagacattctcattcaaactaag
ctggtctcaatgcaagtagacaaccccatggagagctccatcctttcagacgacattgat
gatgaagaagtttggctctactggattgacagcaacaaggaacctcatggcaaagctatc
aggcaccttgctcaagaagcaaaagaaggcaccaaagctgatttggaagttcttacctat
tataggtaccagctaaacctctttgcaaggatgtgcttggatcgccagtatctggccata
aaccagatttctacgcagctctctgtggatttgatcctgcggtgtgtgtcggacgagagc
ctgccatttgacctccgggcgtctttttgtcgtctcatgctccacatgcatgttgaccgg
gatccccaggagtccgttgtgcctgttcgctatgctaggctctggactgaaattcccaca
aagataacaattcatgaatatgattctataacagactcttccagaaatgatatgaagagg
aaatttgcactgacaatggaatttgttgaggaatacttgaaagaagttgtaaatcagcct
tttccttttggggataaagaaaaaaacaaactgacgtttgaggtggtccacttggctcgg
aatcttatatactttggattttatagtttcagtgaattgttaagactaacaagaacactt
ctggccatcctagatattgtacaggcccccatgtcatcgtattttgaaagattaagcaaa
tttcaagacggaggaaacaatgtcatgagaaccatccatggggtgggagagatgatgacc
caaatggtactcagtagaggctctatcttccccatgagtgtgcctgacgttcagcccaac
atccaccccagcaagcaggggagccccgtagagcctgaagatgtgaccgtgatggacacc
aaactgaagattattgagattttgcagtttatcctgagtgtcagactagattataggatc
tcatatatgctgtcaatatataagaaggaattcggagagaacaatgaaaactcggaaacg
tctgccagtggctctccagatacgttactaccatcagccattgttcctgatatagatgaa
attgcctcccaggcagaaactatgtttgctggaagaaaggagaaaaatccagttcaactt
gatgatgaaggaggcaggacctttttacgagtcctcattcatctgatcatgcatgactac
cctcctttgctatcaggagccctgcaactactattcaagcacttcagccagagagcggaa
gtcttacaggcatttaaacaggtgcaattgctggtgtccaatcaagatgtagataactac
aagcaaatcaaggcagatctagaccagcttcgactaactgtagaaaaatctgagttatgg
gttgagaagagcagcagctatgagaatggagaattgggtgaaagtcaagtaaaaggtggt
gaagagccaattgaggaatcaagcattttaagtccagtgcaggatggaacaaggaaacct
cagattgacagcaataagagcaataactaccggattgtaaaggagattttgattcgacta
agtaaactctgtgtgcagaataaaaagtgtcggaatcaacatcaacgattactgaaaaac
atgggagctcattcggtggtgttggaccttctgaagataccctatgaaaagaatgatgaa
aaaatgaacgaagtgatgaatctggcccacacattcctgcagaatttctgtcggggaaat
ccacagaaccaagttctccttcataaacatctgaatttgtttttaactcccggtctcctg
gaagcagagaccatgcggcacatcttcatgaacaactaccatctctgcaatgagatcagc
gagagggtcgtgcagcactttgtgcactgcatcgaaacgcacggccgccacgtggagtac
ctgaggtttttgcaaacgattgtaaaagcagatgggaaatatgtgaagaaatgccaggat
atggtaatgacagagttgataaatgggggtgaagatgtgctgatattttacaatgataga
gcatcatttcccatccttctccatatgatgtgttcagagagagaccgaggggatgagagt
ggtcccttagtctaccacatcaccctggtggaattgctggcagcatgcacagaggggaaa
aatgtctacactgaaatcaagtgcaattcccttctgcccttggacgacatagtgagggtg
gtgacccatgacgactgcatccctgaggttaaaattgcttatgtgaactttgttaatcac
tgttatgtggacactgaagtggaaatgaaagaaatctacacaagtaaccacatctggaaa
ttatttgagaacttcttggtggacatggccagggtttgcaacaccaccacggacaggaaa
cacgcggacacctccttggagaagtgtgtcactgagtcaataatgagcattgtgagcggc
ttctttaattcccccttttcagacaacagtaccagcctccagacacatcaaccagtgttt
atccagctgttgcagtctgccttcagaatctacaattgtacctggccaaacccagcgcag
aaatcctacgtggagtcttgtataagaactttggccgaagtggcaaagaatcgtgggatc
gccattccagtggatttggacagccaagttaatactcttttcctgaagagccactccaat
atggtgcagagagctgccatgggttggagactatctgctcgctctggaccacgctttaag
gaagctcttggagggcctgcttgggattatagaaatattattgaaaagttacaggatgta
gtggcctcattggagcaacagttcagcccgatgatgcaggctgaattctcagtgttggtt
gatgtgctgtacagtccagaactactgttccctgaggggagtgatgcaagaataagatgt
ggtgctttcatgtccaagttgattaatcatacaaagaaactaatggagaaagaagaaaag
ctgtgcattaaaattcttcagactttacgagaaatgctagagaagaaagacagctttgtg
gaagagggtaacacattaagaaaaatactcctgaatcgctactttaaaggagactatgga
gtcgggatgaacggacacctgtctggaacctactgcaaatctgcacaagggggtgggagc
ttttctggacaagattcggataagatggggatatcaatgtcagatattcagtgtctactg
gataaagaaggtgcatcagaacttgtcattgatgttatagtgaacaccaaaaatgacaga
attttttcagaaggcattttacttggcattgccttgctcgagggaggaaatacacagact
cagtattccttctatcagcagttgcatgaacaaaaaaagtcagaaaaattcttcaaagtt
ctgtatgaccgaatgaaggctgctcagaaagagataagatcaacagtgacagttaatacc
atagacttagggaacaaaaaaagggatgatgacaatgaattgatgacgtctggtccacga
atgagagtaagagattcatcattacttttgaaagagggaatgaaagggcaattaacagaa
gcttcttcggcgacgtccaaagcatactgtgcctaccgaagggaaatggatccagaaata
gacatcatgtgtgcgggatcggaagtgggaaacgctgaggaaaagtctgcggaggaagta
acgatgagtcctgcgattgccatcatgcagcccatactgaggtttcttcagttgctctgt
gagaatcacaacagggaactgcagaacttcttgaggaatcaaaacaacaaaacaaattat
aacctggtctgtgagacccttcagttcttggactgcatttgtggaagtaccacgggtggc
ctgggcctgttgggtctctacatcaacgagaagaatgtagtgctggtcaaccagactctg
gagagcttgacggagtattgccagggcccatgccatgaaaatcagacgtgtattgctacc
catgaatcgaatgggattgatatcatcattgccttgattctaaatgacataaaccctctt
ggtaaatatcgaatggatctggtgctccaactgaagaacaatgcctctaagcttttgctg
gccattatggaaagcagacatgacagcgagaatgcagaaagaattcttttcaacatgaga
cccagggaactggtggatgtgatgaagaatgcctataaccaaggactggaatgtgaccat
ggggatgacgagggtggagatgatggtgtttcccctaaagatgttggacacaatatctat
atcctggcccatcagttggctcgtcacaacaaactcttgcagcagatgcttaaaccagga
tcggatccagatgatggggatgaagccttaaaatattacgccaaccacactgcacagatc
gagattgttcggcatgataggacgatggaacaaatagtttttcctgtgcccaatatatgt
gaataccttacacgagaatccaagtgccgtgtgttcaatacaactgaaagggatgaacaa
ggcagtaaagtgaatgactttttccagcaaacagaagatctctacaatgaaatgaagtgg
cagaagaaaatcaggagtaaccctgcactgttctggttctcgaggcacatatccctttgg
gggagcatatccttcaacttggctgtgttcatcaatttagctgttgccctcttctacccg
tttggggatgatggagatgaaggtacactttctccgttgttctcagttcttctttggata
gcagttgcagtctgcacatctatgctgtttttcttctccaagcctgtgggaattcggcca
tttcttgtgtcaataatgctcagatcaatatatacaataggtcttgggcctacgttgata
cttcttggtgcagctaatctttgtaataaaatagtatttctggtgagttttgtgggcaat
cgtggcactttcacccgaggctaccgagcggtcatcctggatatggcctttctctaccac
gtggcatacgtcctggtctgcatgctgggcctttttgtccatgaattcttctatagcttc
ctgctttttgatttggtgtacagagaagagactctgcttaatgtcataaagagtgtcaca
aggaatggccgttccattattctaactgcagtcctggctctcatccttgtctacctgttt
tccattattgggttcctttttctgaaggacgacttcacaatggaggtggataggctgaaa
aacagaactcctattacaggtagtaatgaagttcctactatgactttaacttcaacgatg
gaaacatgtcaaaaggacaactgcacacccacaataccagcttcaaatacagctgatgaa
gagtatgaggatggaattgaaaggacatgtgacactctcctcatgtgcatcgtcaccgtc
ctaaaccagggcctccggaacggcggcggcgtgggagacgttctcagaaggccatcgaaa
gacgagcccttgtttgctgcccgagtggtctatgaccttcttttttatttcattgtcatc
attattgtccttaacttgatttttggtgttatcattgatacttttgctgatctcagaagt
gaaaaacagaaaaaggaagaaattctaaagacaacctgctttatctgtggacttgagagg
gacaagtttgataataaaacggtttcatttgaggagcacatcaagtcagaacacaatatg
tggcattatttgtacttcctagttctggtgaaggttaaagacccaactgaatacactgga
cctgaaagttatgtggctcaaatgatcgtggagaagaatttagactggtttcctcggatg
cgagccatgtccctcgttagcaatgaaggtgacagtgaacaaaatgagattcggaacctg
caggagaagttggaatcaaccatgagcctggtcaaacagctgtcggctcagctggccgag
ctcaaggagcagatgacagaacaaaggaagactaagcagagactgggctttctcggacca
aacacaccccatgtgaatcatcacgtgccgccacactga

KEGG   Ursus maritimus (polar bear): 103665553
Entry
103665553         CDS       T03271                                 

Gene name
ITPR3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04070  Phosphatidylinositol signaling system
umr04114  Oocyte meiosis
umr04210  Apoptosis
umr04218  Cellular senescence
umr04270  Vascular smooth muscle contraction
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04621  NOD-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04713  Circadian entrainment
umr04720  Long-term potentiation
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04728  Dopaminergic synapse
umr04730  Long-term depression
umr04742  Taste transduction
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04915  Estrogen signaling pathway
umr04918  Thyroid hormone synthesis
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04924  Renin secretion
umr04925  Aldosterone synthesis and secretion
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04929  GnRH secretion
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr05010  Alzheimer disease
umr05012  Parkinson disease
umr05014  Amyotrophic lateral sclerosis
umr05017  Spinocerebellar ataxia
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05163  Human cytomegalovirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103665553 (ITPR3)
   04020 Calcium signaling pathway
    103665553 (ITPR3)
   04070 Phosphatidylinositol signaling system
    103665553 (ITPR3)
   04022 cGMP-PKG signaling pathway
    103665553 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103665553 (ITPR3)
   04210 Apoptosis
    103665553 (ITPR3)
   04218 Cellular senescence
    103665553 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103665553 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103665553 (ITPR3)
   04621 NOD-like receptor signaling pathway
    103665553 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    103665553 (ITPR3)
  09152 Endocrine system
   04911 Insulin secretion
    103665553 (ITPR3)
   04922 Glucagon signaling pathway
    103665553 (ITPR3)
   04929 GnRH secretion
    103665553 (ITPR3)
   04912 GnRH signaling pathway
    103665553 (ITPR3)
   04915 Estrogen signaling pathway
    103665553 (ITPR3)
   04921 Oxytocin signaling pathway
    103665553 (ITPR3)
   04935 Growth hormone synthesis, secretion and action
    103665553 (ITPR3)
   04918 Thyroid hormone synthesis
    103665553 (ITPR3)
   04928 Parathyroid hormone synthesis, secretion and action
    103665553 (ITPR3)
   04924 Renin secretion
    103665553 (ITPR3)
   04925 Aldosterone synthesis and secretion
    103665553 (ITPR3)
   04927 Cortisol synthesis and secretion
    103665553 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103665553 (ITPR3)
  09154 Digestive system
   04970 Salivary secretion
    103665553 (ITPR3)
   04971 Gastric acid secretion
    103665553 (ITPR3)
   04972 Pancreatic secretion
    103665553 (ITPR3)
  09156 Nervous system
   04724 Glutamatergic synapse
    103665553 (ITPR3)
   04725 Cholinergic synapse
    103665553 (ITPR3)
   04728 Dopaminergic synapse
    103665553 (ITPR3)
   04726 Serotonergic synapse
    103665553 (ITPR3)
   04720 Long-term potentiation
    103665553 (ITPR3)
   04730 Long-term depression
    103665553 (ITPR3)
   04723 Retrograde endocannabinoid signaling
    103665553 (ITPR3)
  09157 Sensory system
   04742 Taste transduction
    103665553 (ITPR3)
   04750 Inflammatory mediator regulation of TRP channels
    103665553 (ITPR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103665553 (ITPR3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103665553 (ITPR3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103665553 (ITPR3)
   05012 Parkinson disease
    103665553 (ITPR3)
   05014 Amyotrophic lateral sclerosis
    103665553 (ITPR3)
   05017 Spinocerebellar ataxia
    103665553 (ITPR3)
   05020 Prion disease
    103665553 (ITPR3)
   05022 Pathways of neurodegeneration - multiple diseases
    103665553 (ITPR3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103665553 (ITPR3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103665553 (ITPR3)
   05163 Human cytomegalovirus infection
    103665553 (ITPR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103665553 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:umr01009]
    103665553 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:umr04040]
    103665553 (ITPR3)
Protein phosphatases and associated proteins [BR:umr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103665553 (ITPR3)
Ion channels [BR:umr04040]
 Ligand-gated channels
  IP3 receptor
   103665553 (ITPR3)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 103665553
NCBI-ProteinID: XP_008691724
UniProt: A0A384CBA0
LinkDB
Position
Un
AA seq 2499 aa
MWLDESLPLGVKAAAHWDAGLPQQLCPGHCAMPLGYSSFRAGGDRLVDDRCVVEPAAGDL
DNPPKKFRDCLFKVCPMNRYSAQKQYWKAKQTKQDKDKIADVVLLQKLQHAAQMEQKQND
TENKKVHGDVVKYGSVIQLLHMKSNKYLTVNKRLPALLERNAMRVTLDATGNEGSWLFIQ
PFWKLRSNGDNVVVGDKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFM
QFRDHLEEVLKGGDVVRLFHAEQEKFLTCDEYRGKLQVFLRTTLRQSATSATSSNALWEV
EVVHHDPCRGGAGHWNGLYRFKHLATGNYLAAEENPSYKGDACDFRSLSQGAQGRVGRRN
AGEKIKYRLVAVPHGNDIASLFELDPTTLQKTDSFVPRKLGTCPTKEDKEAFAIVSVPVS
EIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLVFFVSDVPNNGQNVLDIM
VTKPNRERQKLMREQNILKQIFGILKAPFRDKGGEGPLVRLEELSDQKNAPYQHMFRLCY
RVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLHNNRKLLEKHITKTEVET
FVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPKNSDILIQTELRPVKEMA
QSHEYLSIEYSEEEVWLTWTDKNNEHHEKSVRQLAQEARAGNAHDENVLSYYRYQLKLFA
RMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRASFCHLMLHVHVDRDPQELVTPV
KFARLWTEIPTAITIKDYDSNLNASRDDKKNKFASTMDFVEDYLNNVVGEAVPFANEEKN
KLTFEVAGQGGKNVRRSIQGVGHMMSSMVLSRKQSVFGAPSLSAGAGPTEPLDRSKFEDN
EDIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPSLGWR
LEDALGPAPQPCLCFLAHLIATVRAANMNLDRIGEQAEAMFGQPGKGDRHLTGVCQALSL
GLALVDFSQRPLATQLLFSFPFYGGGIEAREALLPYPDRSTPIATLQVQLLISAQDVENY
KVIKSELDRLRTMVEKSELWVDKKGSSKGEEVDTGAAKDKKERPTDEEGFLHPPGEKSSE
NYQIVKGILERLNKMCGVGEQLRKKQQRLLKNMDAHKVMLDLLQIPYDKGDAKMLELLRC
THQFLQKFCAGNPGNQALLHKHLHVQYLDFLHTVIKAEGKYVKKCQDMIMTELTNAGDDV
VVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKNVYTEIKCTSLLP
LEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTLFENFTLDMARVC
SKREKRLADPTLEKYVLTVVLDTINAFFSSPFSENSTSLQTHQTIVVQLLQSTTRLLDCP
WLQQQHKGSVEACIRTLAMVAKGRAISLPMDLDAHISSLLSSGASCVAAAQRNASNYKAT
TRSFPRVTPTANQWDYKNIIEKLQDIITALEERLRPLVQAELSVLVGTGLDQDWSAIAAT
QCRLDKEGATKLVCDLITSTKNEKIFQESIGLAIRLLDGGNTEIQKSFYNLMTSDKKSER
FFKVLHDRMKRAQQETKSTVAVNMNDLGSQPREDREPTDPTTKGRVASFSMPGSPSRYSL
GPSLRRGHEVGERGQSNEMGTSVLIMQPILRFLQLLCENHNRDLQNFLRSQNNKTNYNLV
CETLQFLDIMCGSTTGGLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQSCIVTHES
NGIDIITALILNDISPLCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQE
LVDVIKKAYVQEEERENSEVSPREVGHNIYILALQVPAPPVAPPPARPLYPQLSLNNKQL
SQMLKSSAPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLF
TTTEQDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFIN
LIIAFFYPYMEGASTGVLGSPLISLLFWILICFSIAALFTKRYSVRPLIVALILRSIYYL
GIGPTLSILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFV
HELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFI
LEVDRLPGNHSGASPLGMPHGGATFMGTCSGDKLNCVSGVSVPEVLEGEGSVPREPGGGA
RGXRGLGLGGGTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFVVIIIVLNLI
FGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKFEHNMWNYLYFI
VLVRVKNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNST
MKLVSHLTAQLNELKEQMTEQRKRRQRLGFVDVQTCMSR
NT seq 7500 nt   +upstreamnt  +downstreamnt
atgtggctggacgagtccctgcccctgggggtgaaggctgccgcgcactgggacgctggc
ctgcctcagcagctttgccctggccactgtgctatgccgttgggctacagcagcttcagg
gccggcggggacaggttggtggatgaccgctgtgtggtggagcccgcggcgggggacctg
gacaacccccctaagaagttccgagactgcctcttcaaggtgtgtcccatgaaccgctac
tcggcccagaagcagtactggaaggccaagcagaccaagcaggacaaggacaagatcgcc
gacgtggtgctgctccagaagctgcagcacgcagcccagatggagcagaagcagaacgac
acggagaacaagaaggtgcatggggacgtggtgaagtacggcagcgtgatccagctcctg
cacatgaagagcaacaagtacctgacggtgaacaagcggctgccggccctgctggagagg
aacgccatgcgggtgacgctcgatgcaacaggcaacgagggctcctggctcttcatccag
cctttctggaagctgcggagcaacggggacaatgtggtggtgggggacaaggtgatcctg
aatcctgtcaacgccgggcagcctctgcacgccagcaattacgagctcagtgacaacgcg
ggctgcaaggaggtcaactccgtgaactgcaacaccagctggaagatcaacctgttcatg
cagttccgagaccacctggaggaggtgctgaaagggggagatgtggtgcggctgttccac
gcggagcaggagaagttcctgacgtgtgacgagtacaggggcaagctgcaggtgttcctg
cgtaccacgctacgccagtctgccacctcggccaccagctccaatgccctctgggaggtg
gaggtggtccaccacgacccctgccgcggaggagctggccactggaacggcctgtaccgc
ttcaagcacctggccacaggcaactacctggccgccgaggagaaccccagctacaagggt
gatgcctgtgattttagatccttatcccagggtgctcagggtcgagtaggtcgccggaac
gctggggagaagatcaagtaccgcctggtggctgtgccccacggcaatgacatcgcctcc
ctctttgagctggaccctaccacgttgcagaaaaccgactcctttgtgccccgaaagctg
ggcacctgccccaccaaggaagacaaggaggcctttgccatcgtgtcggtgcccgtgtcc
gagatccgagacctggacttcgccaacgatgccagctccatgctggccagtgccgtggag
aaactcaatgagggcttcatcagccagaatgaccgcaggtttgtcatccagctgctggag
gacctggtgttcttcgtcagcgacgtccccaacaatgggcagaatgtgctggacatcatg
gtcaccaagcccaaccgggaacggcagaagctgatgagggagcagaacattctcaagcag
atcttcggcattctgaaggcccctttccgtgacaaggggggcgagggccccctagtgcga
ctagaggagctgtcagaccagaagaatgccccctaccagcacatgttccgtctctgctac
cgggtgctgcggcactcccaggaggattaccgcaagaatcaggagcacatcgccaagcag
tttgggatgatgcagtcccagatcggctacgacatcctggcggaggacaccatcaccgcc
ctgctgcacaacaaccgcaagctcctggagaagcacatcaccaagaccgaggtggagacc
ttcgtcagcctcgtgcggaagaaccgggagcccaggttcctggactacctctcggacctg
tgtgtgtccaaccacatcgccatccccgtcacccaggagctcatctgcaagtgtgtgctg
gaccccaagaacagcgacattctcatccagaccgagcttcggcccgtgaaggagatggcc
cagtcccacgagtacctgagcatcgagtactccgaggaggaggtgtggctcacttggacc
gacaagaataacgagcaccacgagaagagcgtgaggcagctggcccaggaggcgcgggcg
ggcaacgcccacgacgagaacgtgctcagctactacaggtaccagctgaagctcttcgcc
cgcatgtgcctggaccgccagtacctggccatcgacgagatctcgcagcagctgggcgtt
gacctcatcttcctatgcatggcagacgaaatgctgccctttgacctacgcgcctccttc
tgccacctgatgctgcacgtgcatgtggacagggacccccaggagctggtcacgccggtc
aagttcgcccgcctctggaccgagatccccacagccatcaccatcaaagactatgattcc
aacctgaacgcctctcgcgacgacaagaagaacaagttcgccagcaccatggacttcgtg
gaggactacctcaacaacgtggtcggcgaggccgtgccctttgccaacgaggagaagaac
aagctcaccttcgaggttgctgggcaggggggtaagaacgttcgacggtccatccagggc
gtgggtcacatgatgtcctccatggtgctgagccgcaagcagtctgtcttcggcgcccct
agcctgtctgccggcgctggccccacggagccgctggatagaagcaagttcgaggacaat
gaggacattgtggtgatggagaccaagctgaagatcctggaaatcctgcagttcatcctc
aatgtccgcctggactaccgcatctcatacctgctctccgtcttcaagaaggagtttgtg
gaagtgtttcccatgcaggacagcggggctgacggcacagccccgtccttggggtggagg
ctggaggatgccttggggccagctccccagccctgcctctgtttcctagcccatttaatt
gccacggtgagagctgccaacatgaacctggaccgcatcggggagcaggcggaggccatg
ttcggacaacctgggaaaggcgaccggcatttaacgggcgtgtgccaggcactgagcctt
ggcctcgcattagtggacttctcgcagcggcccctggcaacacagttactattctcgttc
ccgttttacggagggggcattgaggcccgggaagctctcctcccttaccctgaccggagc
acgcccatcgccaccctgcaggtgcagctgctgatctctgctcaggatgtggagaactac
aaggtgatcaagtcggagctggaccggctgcggaccatggtggagaagtcggagctgtgg
gtggacaagaagggcagcagcaagggcgaggaggtggacacaggtgctgccaaagacaag
aaggagcggcccacagacgaggagggctttctgcacccacctggggagaagagcagtgag
aactaccagatcgtcaagggcatcctggaacggctgaacaagatgtgcggtgtgggggag
cagctgaggaagaagcagcagaggctgctcaagaacatggacgcccacaaggtcatgctg
gacctgttgcagatcccctatgacaagggtgacgccaagatgctggagctcctgcgctgc
acgcaccagttcctgcagaagttctgcgccgggaaccccggcaaccaggccctgctgcac
aagcacctgcacgtgcagtacctggacttcctgcacaccgtcatcaaggccgagggcaag
tacgtcaagaagtgccaggacatgatcatgaccgagctgaccaacgcgggtgacgacgtg
gtggtgttctacaatgacaaggcctcgctggcccacctgctggacatgatgaaggccgcc
cgggatggcgtggaggaccacagccccctcatgtaccacatctccctggtggacttgctg
gccgcctgcgccgagggcaagaacgtctacacggagatcaagtgcacctccctgctgccc
ctggaggacgtggtgtctgtggtgacacatgaggactgcatcactgaggtgaaaatggct
tacgtgaacttcgtgaatcactgctatgtggacacagaggtggagatgaaggagatttac
accagcaaccacatctggactctcttcgagaacttcaccctggacatggctcgggtgtgc
agtaagcgggagaagcgcctggctgaccccacgctggagaagtacgttctgaccgtggtg
ctggacaccatcaacgcgttcttcagctctccgttctctgagaacagcacctccctgcag
acacaccagaccatcgtggtgcagctgctgcagtccaccacgcggctgctcgattgtccg
tggctgcagcagcagcacaagggctccgtggaggcctgcatccggaccctcgccatggtg
gccaaaggccgggccatctcgctgcccatggacctggatgcgcacatcagctcgctgctc
agcagtggcgccagctgcgtggccgctgcccagcgcaacgcctccaactacaaggcgacc
acacggtccttcccccgggtcacgcccaccgccaaccagtgggactacaagaacatcatt
gagaagctgcaggacatcatcacggccctggaggagcggctgaggcccctggtacaggcg
gagctgtcggtgttggtgggcaccggcctggaccaagactggtcagcaattgcggccacc
cagtgccggctggacaaggagggggccaccaagctggtatgtgacctgatcaccagcacc
aagaatgagaagatctttcaggagagcattggcctggccatccgcctgctggacggtggc
aacaccgagatccagaaatccttctacaacctgatgacgagtgacaagaagtcagagcgc
ttcttcaaagtgttacacgaccgcatgaagcgggcccagcaggagaccaagtccacggtg
gccgtcaacatgaacgacctgggcagccagccgcgtgaggaccgggagccaacagacccc
accaccaaaggccgcgtagcttccttctcgatgccgggctccccatcccgctattcgctg
ggccccagcctgcgccggggccacgaggtgggcgagcgtggacagagcaacgagatgggc
acgtctgtgctcatcatgcagcccatcctgcgcttcctgcagctgctgtgtgagaatcac
aaccgggacctgcagaacttcctgcgctcccagaacaacaagaccaactacaacctggtg
tgcgagacgctccagttcctggacatcatgtgcggcagcaccacgggcggcctggggctg
ctgggcctttacatcaatgaggacaacgtgggccttgtcatccagaccctggagaccctc
actgagtactgccagggcccctgccacgagaaccagagctgcatcgtgacgcacgagtcc
aacggcatagacatcatcactgcgctgatcctgaacgacatcagtcccctgtgcaagtac
cgcatggatctggtgctgcagctcaaggacaatgcctccaagctgctcttggctctgatg
gagagccggcacgacagtgaaaacgcggaacgaatcctcatcagcctgcggccccaggag
ctggtggacgtcatcaagaaggcctacgtgcaggaggaggagcgtgagaactcagaggtg
agcccacgcgaagtgggccacaatatctacattctggcgctgcaggtaccagcccccccc
gtggccccgcccccggcgcggcccctctacccccagctcagcctcaacaacaagcagcta
tcccagatgctcaagtcctcagcgcctgcccaggaggaggaggaggaccccctggcctac
tacgagaaccacacgtcccagatagagatcgtgcggcaggaccgcagcatggagcagata
gtgttcccggtgcctggcatctgccagttcttgacggaggagaccaagcaccggctcttc
accaccacggagcaggacgagcagggcagcaaagtgagcgacttcttcgaccagtcctcc
ttcctgcacaacgaaatggaatggcagcgcaagctccgcagcatgccactgatctactgg
ttctcccgccgcatgaccctgtggggcagtatttccttcaacctggcggtctttatcaac
ctcatcatcgccttcttctacccctacatggagggcgcgtccacaggcgtgctgggctcc
ccactcatctcgctgctcttctggatcctcatctgcttctccatcgccgccctgttcacc
aagcgctacagcgtccggcccctcatcgtggcgctcattctgcgctccatctactacctg
ggcatcgggcccacactcagcatcctgggcgccctcaacctgaccaacaagatcgtcttt
gtggtgagcttcgtgggcaaccgcggcaccttcatccggggctataaggccatggtcatg
gacatggagttcctctaccacgtgggctacatcctgaccagtgtcctgggcctcttcgtc
cacgagctcttctacagcatcctgctctttgacctcatctaccgtgaggagacgctgttc
aacgtcatcaagagcgtgactcgcaatggccgctccatcctgctgaccgccctgctggcc
ctcatcctcgtctacctcttctccatcgttggcttcctcttcctcaaggatgacttcatc
ctcgaagtcgaccggttgcccggcaatcactctggagccagtcccctgggcatgccacat
ggaggtgccacattcatgggcacgtgcagcggggacaagctgaactgtgtgtcaggggtc
tcggtgcctgaggtcctggaaggtgagggcagtgtgcctcgggagcctgggggaggggcg
cgggggnncagggggctcggcctgggtgggggcactgtcatgaaccacgggctgcgcaac
ggtggcggcgtgggcgacattctccgcaagccctccaaagacgagtctctcttcccggcc
cgcgtggtctacgacctcctgttcttctttgttgtcatcatcatcgtgctgaaccttatc
ttcggtgtgatcatcgacacctttgccgacctgcgcagcgagaagcagaagaaggaggag
attctcaagaccacgtgcttcatctgcggtctggagagagacaagtttgataacaagacc
gtgtcatttgaggagcacatcaagttcgaacacaacatgtggaactacctgtacttcatc
gtgctggtccgcgtgaaaaacaagacggactacacgggccccgagagctacgtggcccag
atgatcaagaacaagaacctggactggttcccccggatgagggccatgtccctagtgagc
aacgagggggaaggggagcagaatgagatccggattcttcaggacaagctcaactccacc
atgaagctggtgtctcacctcactgcccagctcaacgagctcaaggagcagatgacagag
cagcggaagcgcaggcaacgcctgggctttgtggacgtccagacctgcatgagccgctga

KEGG   Ursus maritimus (polar bear): 103669597
Entry
103669597         CDS       T03271                                 

Gene name
ITPR1
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04070  Phosphatidylinositol signaling system
umr04114  Oocyte meiosis
umr04140  Autophagy - animal
umr04210  Apoptosis
umr04218  Cellular senescence
umr04270  Vascular smooth muscle contraction
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04621  NOD-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04713  Circadian entrainment
umr04720  Long-term potentiation
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04728  Dopaminergic synapse
umr04730  Long-term depression
umr04750  Inflammatory mediator regulation of TRP channels
umr04912  GnRH signaling pathway
umr04915  Estrogen signaling pathway
umr04918  Thyroid hormone synthesis
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04924  Renin secretion
umr04925  Aldosterone synthesis and secretion
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04929  GnRH secretion
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr05010  Alzheimer disease
umr05012  Parkinson disease
umr05016  Huntington disease
umr05017  Spinocerebellar ataxia
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05163  Human cytomegalovirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103669597 (ITPR1)
   04020 Calcium signaling pathway
    103669597 (ITPR1)
   04070 Phosphatidylinositol signaling system
    103669597 (ITPR1)
   04022 cGMP-PKG signaling pathway
    103669597 (ITPR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103669597 (ITPR1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103669597 (ITPR1)
   04210 Apoptosis
    103669597 (ITPR1)
   04218 Cellular senescence
    103669597 (ITPR1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103669597 (ITPR1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103669597 (ITPR1)
   04621 NOD-like receptor signaling pathway
    103669597 (ITPR1)
   04625 C-type lectin receptor signaling pathway
    103669597 (ITPR1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103669597 (ITPR1)
   04929 GnRH secretion
    103669597 (ITPR1)
   04912 GnRH signaling pathway
    103669597 (ITPR1)
   04915 Estrogen signaling pathway
    103669597 (ITPR1)
   04921 Oxytocin signaling pathway
    103669597 (ITPR1)
   04935 Growth hormone synthesis, secretion and action
    103669597 (ITPR1)
   04918 Thyroid hormone synthesis
    103669597 (ITPR1)
   04928 Parathyroid hormone synthesis, secretion and action
    103669597 (ITPR1)
   04924 Renin secretion
    103669597 (ITPR1)
   04925 Aldosterone synthesis and secretion
    103669597 (ITPR1)
   04927 Cortisol synthesis and secretion
    103669597 (ITPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103669597 (ITPR1)
  09154 Digestive system
   04970 Salivary secretion
    103669597 (ITPR1)
   04971 Gastric acid secretion
    103669597 (ITPR1)
   04972 Pancreatic secretion
    103669597 (ITPR1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103669597 (ITPR1)
   04725 Cholinergic synapse
    103669597 (ITPR1)
   04728 Dopaminergic synapse
    103669597 (ITPR1)
   04726 Serotonergic synapse
    103669597 (ITPR1)
   04720 Long-term potentiation
    103669597 (ITPR1)
   04730 Long-term depression
    103669597 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    103669597 (ITPR1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103669597 (ITPR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103669597 (ITPR1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103669597 (ITPR1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103669597 (ITPR1)
   05012 Parkinson disease
    103669597 (ITPR1)
   05016 Huntington disease
    103669597 (ITPR1)
   05017 Spinocerebellar ataxia
    103669597 (ITPR1)
   05020 Prion disease
    103669597 (ITPR1)
   05022 Pathways of neurodegeneration - multiple diseases
    103669597 (ITPR1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103669597 (ITPR1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103669597 (ITPR1)
   05163 Human cytomegalovirus infection
    103669597 (ITPR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103669597 (ITPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:umr01009]
    103669597 (ITPR1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:umr04040]
    103669597 (ITPR1)
Protein phosphatases and associated proteins [BR:umr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103669597 (ITPR1)
Ion channels [BR:umr04040]
 Ligand-gated channels
  IP3 receptor
   103669597 (ITPR1)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 103669597
NCBI-ProteinID: XP_008696160
UniProt: A0A384CNY4
LinkDB
Position
Un
AA seq 2703 aa
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGGNSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQDKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSTGENALEAGEDEEEVWLFWRDSSKEIRSKSVRELAQDAK
EGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRAS
FCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGTSKDEIKERFAQTMEFV
EEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHV
TTIFPISKMAKGEENKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQAEP
EKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSETSSGNSSQEG
PSNVPGTLDFEHIEEQAEGIFGGRKENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGAL
QLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPD
EAMDGASGENEHKKTEEGNNKSQKHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRKQ
QQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHIN
LFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEG
KFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVEL
LAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEI
YTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTT
LQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNN
LFLKSHNIVQKTAMNWRLTARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQA
ELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLRE
MMTKDRGYGEKGEALRQILVNRYYGNVRPSGRRESLTSFGNGPLSPGGPSKPGGGGGGSG
SSSTSRGEMSLAEVQCHLDKEGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQH
SFFCRLTEDKKSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEIDRDAPSRKKA
KEPSTQITEEVRDQLLEASAATRKAFSTFRREADPDDHYQSGEGAQATADKTKDELEMSA
VITIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLL
GLYINEKNVALINQTLESLTEYCQGPCHENQNLTSTHPCNIITALILNDINPLGKKRMDL
VLELKNNASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGENGED
GAASPRNVGHNIYILAHQLARHNKELQTMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRT
MEQIVFPVPSICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQP
VLYWCARNMSFWSSISFNLAVLMNLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLISLAIV
IALPKPHGIRALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYR
AMVLDVEFLYHLLYLLICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILT
AVLALILVYLFSIVGYLFFKDDFILEVDRLLSLPEAGESLASEFLYSDVCRVETGENCSS
PAPKEELVLAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARV
IYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVT
FEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSD
SEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRLGLLGHPPHVHVNPQ
QPA
NT seq 8112 nt   +upstreamnt  +downstreamnt
atgtctgacaagatgtctagtttcctacatattggagacatttgttctctgtacgcggaa
ggatcgacaaatggatttattagcaccttgggcctggttgatgatcgttgtgttgtacag
ccagaagctggggaccttaataatccacccaagaaattcagagattgcctctttaagcta
tgtcccatgaatcgctactctgcccagaagcagttctggaaagctgccaagccagggggc
aacagcacaacagatgccgtactgctcaacaaactacaccatgctgcagacttggaaaag
aagcagaatgagacagaaaacaggaaattgctggggaccgtaatccagtatggcaacgtg
atccagctcctgcatttgaaaagtaataaatacctaactgtgaataagaggcttccagct
ctgctggagaagaacgccatgagagtgactttggacgaggcgggaaatgagggctcctgg
ttttacattcagccattctacaagctgcgctccatcggagacagtgtggtcataggtgac
aaggttgtactgaaccccgtcaatgctggccagcccctacatgccagcagccatcagctg
gtggataaccccggctgcaacgaggtcaattctgtcaactgcaatacaagctggaaaata
gtccttttcatgaaatggagtgacaacaaagatgacatcctgaaggggggtgacgtggta
aggctgttccatgcggagcaggagaagttccttacctgcgacgaacacaggaagaaacag
cacgtcttcctgagaaccacgggccgacagtcagccacatctgccacgagttcaaaagcg
ctgtgggaggtggaggtagtccaacatgacccatgtcggggtggagcaggatattggaac
agcctcttccgttttaagcatcttgctacagggcattacttagcagcagaggtagaccct
gactttgaggaagaatgcctggagtttcagccctcagtggaccctgatcaggacgcctct
cgaagcaggttgcgaaatgcccaagacaagatggtgtactccctggtctctgtgcctgag
ggcaatgacatctcctccatttttgagctagaccccaccactctccgtggaggtgatagc
cttgttccaagaaactcctacgtccggctcagacacctgtgcactaatacctgggttcac
agcacaaatatccccatcgacaaagaagaggaaaaacccgtgatgctgaaaatcggcacc
tcccccgtgaaagaggataaggaagcgtttgccatagttccagtctcccccgctgaggtc
cgggacctggattttgccaacgatgccagcaaggtgctgggctccatagccgggaagctg
gagaagggcaccatcacccagaatgaaagaaggtctgtgaccaagctgctggaagacttg
gtttactttgtcacgggcggcactaactctggtcaagatgtccttgaggtggtcttctcc
aagcccaacagagaacggcagaagctgatgagagaacagaatatcctcaagcagatcttc
aagttgttacaagccccattcacagactgtggcgatggccccatgctgcggctggaggag
ctaggggaccagcggcacgcccctttcagacatatctgccggctctgctacagggtcctg
agacactcgcagcaagactacaggaaaaaccaggagtacatagccaagcagtttggcttc
atgcagaagcagattggctatgatgtgttggccgaagacaccatcactgccctgcttcac
aataaccgaaaactcctggagaaacacatcaccgctgctgagatcgacacgtttgtcagt
ctggtgcgaaagaacagggagcccagattcttagattatctctccgacctctgcgtgtcc
atgaacaaatcgatcccagtgacccaggaactgatatgtaaagccgtgctgaatccaacc
aatgctgacatcctgattgagaccaagttggttctttctcgttttgaatttgagggtgtt
tctactggagagaatgctctggaggcaggagaggatgaagaggaggtgtggctcttctgg
agggacagcagcaaggagattcgcagcaagagcgtcagggaactggcccaggatgccaaa
gaaggacaaaaggaagaccgagacgttctcagctactacaggtatcagttgaaccttttt
gctaggatgtgtctagaccgccagtacctggccatcaatgaaatatcaggccagctggat
gtcgatctcattctccgctgcatgtctgacgagaacctgccctatgatctgagggcgtcc
ttctgccgtctcatgcttcatatgcacgtggaccgagatccccaggaacaagtcactccc
gtgaaatacgcccgcctgtggtctgagattccctcggagatcgccattgatgactatgat
agtagcggaacttccaaagatgaaattaaggagaggtttgcacagaccatggaatttgtg
gaggagtacttaagagatgtggtttgtcagaggtttcctttctctgataaggagaaaaat
aagcttacctttgaggttgtaaatttagctaggaatctcatatactttggtttctacaac
ttctctgaccttctacgattaaccaaaatcctcctggccatactggactgcgtgcacgtg
acgaccatctttcccattagcaagatggcgaaaggagaagagaataaaggcagtaacgta
atgcggtccatccacggggttggagagctgatgacccaggtggtgctccggggaggaggc
tttttgcccatgactcccatggctgctgcccctgagggcaatgtgaaacaggcagaacca
gagaaggaggacatcatggtcatggacaccaagttgaagatcattgaaatactccagttt
attttgaatgtgaggttggattataggatctcctgcctcctgtgtatattcaagcgagag
tttgatgaaagcaattcccagacttcggaaacatcctccggaaacagcagccaagagggg
ccaagtaatgtaccaggtactcttgactttgaacacattgaagagcaagcagaaggcatc
tttggaggaaggaaagagaacacccccctggacttggatgaccacggcggcagaaccttc
ctccgagtcttgctgcatttgacgatgcacgactacccacccctggtgtcaggggccctg
cagcttctcttccggcacttcagtcagaggcaggaggtcctgcaggccttcaaacaggtc
cagctgcttgttaccagccaagatgtcgacaactacaaacagatcaaacaagacttggat
cagctgcgatccatcgtggaaaagtcggagctctgggtgtacaaagggcagggccctgac
gaggccatggatggagcctctggtgaaaatgaacataagaaaacagaggaggggaataac
aagtcacaaaagcatgagagcaccagcagctacaactatagggtggtaaaagagattctg
attcggctgagcaaactctgtgttcaggagagcgcgtcggtgaggaagagcaggaagcag
cagcagcgcctgctgcggaacatgggcgcgcacgccgtggtgctggagctgctgcagatt
ccctacgagaaggctgaagataccaagatgcaggagataatgaggctggctcatgaattc
ctgcagaatttctgtgcaggcaaccagcagaatcaagccttgctacacaagcatataaac
ctgtttctcaacccagggatcctggaggcggtcaccatgcagcacatcttcatgaacaat
ttccagctctgcagtgagatcaatgagcgggttgtccagcactttgttcactgcattgag
actcacggtcgaaacgtccagtacataaaattcttacagacgatcgtcaaggcagaaggg
aaattcatcaaaaagtgccaagacatggtcatggctgagctggttaattcgggagaggac
gtcctcgtgttctacaacgacagagcctctttccagaccctgatccagatgatgaggtca
gagcgggaccggatggacgagaacagccctctcatgtaccacatccacctggtggagctc
ttggccgtgtgcaccgagggcaagaacgtctacacagagataaagtgcaactctctgctc
ccactggatgacattgtccgcgtcgtgacccacgaggactgcatccccgaggttaaaatt
gcgtacattaacttcctcaatcactgctatgtggatactgaggtggaaatgaaggagatt
tacaccagcaatcatatgtggaaattgtttgagaatttccttgtggacatctgcagggcc
tgtaacaacaccagtgacaggaagcacgcagactcaattttggagaagtacgttactgaa
attgtcatgagtatcgttactaccttcttcagttctcccttctcagaccagagcacgacg
ctgcagactcgccagcctgtctttgtgcaactgctgcaaggtgtgttcagggtttaccac
tgcaactggttaatgccgagccaaaaagcctctgtggagagctgtattcgggtgctctct
gacgtagccaagagccgggccattgctattcctgtggacctggacagccaagtcaacaac
ctcttcctgaagtcccacaacatcgtacagaaaactgccatgaactggcggctgactgcc
cgcaatgcagctcgcagagactctgttctggcagcttctagagactaccggaatatcatt
gagagattgcaggacatcgtctcagccctggaggaccgtctaaggcccctggtccaggca
gagttatctgtgcttgtggacgtgctccacagacccgagctgcttttcccagagaacaca
gatgccagaagaaagtgcgaaagtggtggcttcatttgcaagttaataaagcatactaaa
cagttgctagaggagaatgaggaaaaactctgcattaaggtcctacagaccctccgagaa
atgatgaccaaagatagaggctatggagaaaagggtgaggcgctcaggcaaattttggtc
aaccgttactatggaaacgtcagaccttcaggaagaagagaaagcctcaccagctttggc
aatggcccgctgtcaccaggaggacccagcaagcctgggggaggagggggaggctctggg
tccagctccacgagcaggggcgagatgagcctggctgaggttcagtgccacctcgacaag
gagggcgcctccaatctggtcattgacctcataatgaacgcgtccagtgatcgagtgttt
cacgaaagcattctcctggccatcgccctcctggaaggaggcaacaccaccatacagcac
tcctttttctgccggttaacagaagataagaagtcagaaaagttctttaaggtcttctat
gaccgaatgaaggtggcccagcaggaaatcaaagcaacagtgaccgtgaacaccagtgac
ttggggaataaaaagaaagatgatgaaatagacagggatgccccatcacggaaaaaagcc
aaagagccctcgacacaaataacggaagaggtccgcgatcagctccttgaggcctctgct
gccactaggaaagccttcagcaccttccggagggaggctgaccccgatgaccactaccag
tccggggaaggtgcccaagccacggcagacaagaccaaggacgagctggagatgagcgcg
gtcatcaccatcatgcagcccattctccggttcctacagctcctgtgcgaaaaccacaac
agggacctgcagaacttccttcgttgccaaaacaacaagaccaactacaatttggtgtgt
gagacgctgcagttcctggactgtatttgtggaagcactactggaggtcttggtcttctc
gggctctatataaatgaaaagaatgtagccctcatcaaccaaaccctggaaagtctgacc
gaatactgtcaaggaccatgccatgagaaccagaacttgacatcaacccatccctgcaac
atcatcacagccctgatccttaatgacatcaatcctttgggaaagaagaggatggacctt
gtattagaactgaagaacaacgcttccaagttgctgctggccatcatggagagcaggcat
gacagtgagaacgcggagcgaatcctttataacatgaggccgaaggaactggtggaagtg
atcaagaaagcctacatgcaaggtgaggtggaatttgaggatggcgaaaacggcgaggac
ggagctgcctcccccaggaacgtggggcacaacatctacatattggcccatcagctggct
cggcataacaaagaacttcagaccatgctgaaacctggaggccaagtggatggggatgaa
gctctggagttttatgccaagcacacggcccagatagagattgtcagattagaccgaacc
atggaacagattgtgttccctgtgcccagcatatgtgaattcctaaccaaggagtcgaaa
ctgcgaatatactacactacagagagggacgagcaaggcagcaagatcaatgacttcttc
ctgcggtccgaggacctcttcaatgaaatgaactggcagaagaaactgagagcccagccc
gttctgtactggtgtgcccgcaacatgtctttctggagcagcatttcgtttaacctggct
gtcctgatgaatctgcttgtggcgtttttctacccatttaaaggagtccgaggaggaacc
ctggagccacactggtcaggactgctgtggacagccatgctcatctctctggccattgtc
attgccctccccaagccccatggcatccgggccttaattgcttctacaattctccggttg
atattttcggttggattacaacccacgttgtttcttctgggagctttcaatgtctgcaat
aaaatcatctttctaatgagctttgtgggcaactgtggaacattcaccagaggctaccga
gccatggttctggatgttgagttcctttaccatttgttgtatttgctgatctgcgccatg
ggcctcttcgtccacgagttcttctacagtctgctgctttttgatttggtatacagagaa
gagactctgcttaatgtcattaaaagtgtcactcgcaatggacggtccatcatcctgaca
gctgttctggctttgatcctggtttacctgttctcaatagtgggctatcttttcttcaaa
gacgattttatcttggaagtagataggttactttctcttccagaagccggcgagagtttg
gcaagcgagttcctatactctgacgtgtgtagggtggagactggggagaactgctcctct
cctgcacccaaagaagagctggtccttgcggaagagacggagcaagacaaagagcacacg
tgtgagactctgctcatgtgcatcgtcacggtgctgagtcacgggctgaggagcgggggc
ggagtgggagacgtgctcaggaagccatccaaagaggagcccctctttgctgctagagtg
atctatgacctcttgttcttcttcatggtcatcatcatcgtccttaatctgattttcggg
gtcatcattgacacctttgctgacctgaggagcgagaagcagaagaaggaggagatctta
aagaccacgtgctttatctgcggcttggagagagacaagttcgacaacaagaccgtcacc
tttgaagagcacatcaaggaggaacacaacatgtggcattacctgtgcttcatcgtgctg
gtgaaggtgaaggactccacagagtacacggggcccgagagctacgtggcggaaatgatc
aaggaaagaaaccttgactggttccccaggatgagagccatgtccttggtcagcagtgac
tctgaaggagagcagaatgagctgaggaacctgcaggagaagctggagtccaccatgaag
ctggtcaccaacctttccggccagctgtcagaattaaaggatcagatgacagagcaaagg
aagcagaaacaaagactcggtcttctaggacaccctccgcacgtgcacgtcaacccacag
cagccagcgtaa

DBGET integrated database retrieval system