Ursus maritimus (polar bear): 103665451 Help Entry 103665451         CDS       T03271                                  Gene name MAPK14 Definition (RefSeq) mitogen-activated protein kinase 14   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism umr  Ursus maritimus (polar bear) Pathway umr01522   Endocrine resistance umr04010   MAPK signaling pathway umr04015   Rap1 signaling pathway umr04068   FoxO signaling pathway umr04071   Sphingolipid signaling pathway umr04114   Oocyte meiosis umr04218   Cellular senescence umr04261   Adrenergic signaling in cardiomyocytes umr04370   VEGF signaling pathway umr04380   Osteoclast differentiation umr04550   Signaling pathways regulating pluripotency of stem cells umr04611   Platelet activation umr04613   Neutrophil extracellular trap formation umr04620   Toll-like receptor signaling pathway umr04621   NOD-like receptor signaling pathway umr04622   RIG-I-like receptor signaling pathway umr04625   C-type lectin receptor signaling pathway umr04657   IL-17 signaling pathway umr04658   Th1 and Th2 cell differentiation umr04659   Th17 cell differentiation umr04660   T cell receptor signaling pathway umr04664   Fc epsilon RI signaling pathway umr04668   TNF signaling pathway umr04670   Leukocyte transendothelial migration umr04714   Thermogenesis umr04722   Neurotrophin signaling pathway umr04723   Retrograde endocannabinoid signaling umr04728   Dopaminergic synapse umr04750   Inflammatory mediator regulation of TRP channels umr04912   GnRH signaling pathway umr04914   Progesterone-mediated oocyte maturation umr04917   Prolactin signaling pathway umr04926   Relaxin signaling pathway umr04933   AGE-RAGE signaling pathway in diabetic complications umr04935   Growth hormone synthesis, secretion and action umr05014   Amyotrophic lateral sclerosis umr05020   Prion disease umr05022   Pathways of neurodegeneration - multiple diseases umr05132   Salmonella infection umr05133   Pertussis umr05135   Yersinia infection umr05140   Leishmaniasis umr05142   Chagas disease umr05145   Toxoplasmosis umr05152   Tuberculosis umr05161   Hepatitis B umr05163   Human cytomegalovirus infection umr05167   Kaposi sarcoma-associated herpesvirus infection umr05169   Epstein-Barr virus infection umr05170   Human immunodeficiency virus 1 infection umr05171   Coronavirus disease - COVID-19 umr05205   Proteoglycans in cancer umr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer umr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103665451 (MAPK14)    04015 Rap1 signaling pathway     103665451 (MAPK14)    04370 VEGF signaling pathway     103665451 (MAPK14)    04668 TNF signaling pathway     103665451 (MAPK14)    04068 FoxO signaling pathway     103665451 (MAPK14)    04071 Sphingolipid signaling pathway     103665451 (MAPK14)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     103665451 (MAPK14)    04218 Cellular senescence     103665451 (MAPK14)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     103665451 (MAPK14)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103665451 (MAPK14)    04613 Neutrophil extracellular trap formation     103665451 (MAPK14)    04620 Toll-like receptor signaling pathway     103665451 (MAPK14)    04621 NOD-like receptor signaling pathway     103665451 (MAPK14)    04622 RIG-I-like receptor signaling pathway     103665451 (MAPK14)    04625 C-type lectin receptor signaling pathway     103665451 (MAPK14)    04660 T cell receptor signaling pathway     103665451 (MAPK14)    04658 Th1 and Th2 cell differentiation     103665451 (MAPK14)    04659 Th17 cell differentiation     103665451 (MAPK14)    04657 IL-17 signaling pathway     103665451 (MAPK14)    04664 Fc epsilon RI signaling pathway     103665451 (MAPK14)    04670 Leukocyte transendothelial migration     103665451 (MAPK14)   09152 Endocrine system    04912 GnRH signaling pathway     103665451 (MAPK14)    04914 Progesterone-mediated oocyte maturation     103665451 (MAPK14)    04917 Prolactin signaling pathway     103665451 (MAPK14)    04926 Relaxin signaling pathway     103665451 (MAPK14)    04935 Growth hormone synthesis, secretion and action     103665451 (MAPK14)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     103665451 (MAPK14)   09156 Nervous system    04728 Dopaminergic synapse     103665451 (MAPK14)    04723 Retrograde endocannabinoid signaling     103665451 (MAPK14)    04722 Neurotrophin signaling pathway     103665451 (MAPK14)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     103665451 (MAPK14)   09158 Development and regeneration    04380 Osteoclast differentiation     103665451 (MAPK14)   09159 Environmental adaptation    04714 Thermogenesis     103665451 (MAPK14)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     103665451 (MAPK14)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103665451 (MAPK14)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103665451 (MAPK14)    05020 Prion disease     103665451 (MAPK14)    05022 Pathways of neurodegeneration - multiple diseases     103665451 (MAPK14)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103665451 (MAPK14)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103665451 (MAPK14)   09171 Infectious disease: bacterial    05132 Salmonella infection     103665451 (MAPK14)    05135 Yersinia infection     103665451 (MAPK14)    05133 Pertussis     103665451 (MAPK14)    05152 Tuberculosis     103665451 (MAPK14)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103665451 (MAPK14)    05161 Hepatitis B     103665451 (MAPK14)    05171 Coronavirus disease - COVID-19     103665451 (MAPK14)    05163 Human cytomegalovirus infection     103665451 (MAPK14)    05167 Kaposi sarcoma-associated herpesvirus infection     103665451 (MAPK14)    05169 Epstein-Barr virus infection     103665451 (MAPK14)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103665451 (MAPK14)    05140 Leishmaniasis     103665451 (MAPK14)    05142 Chagas disease     103665451 (MAPK14)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     103665451 (MAPK14)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:umr01001]     103665451 (MAPK14) Enzymes [BR:umr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      103665451 (MAPK14) Protein kinases [BR:umr01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    103665451 (MAPK14) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like Motif Other DBs NCBI-GeneID:  103665451 NCBI-ProteinID:  XP_008691617 UniProt:  A0A384C9Y1 LinkDB All DBs Position Un AA seq 368 aa AA seqDB search FAGSGTATTGTSAGAAAGAEQKKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAV KKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGAD LNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLA RHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQL KLILRLVGTPGADLLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLD SDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP LDQEEMES NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt ttcgctggctctggaacggcgaccactggaacctcagcgggcgctgcagctggagcggag cagaaaaagacaatctgggaggtgcccgagcgttaccagaatctgtccccggtgggctcc ggtgcctatggctccgtgtgtgctgcttttgacacaaaaactgggttacgtgtggcagtg aagaagctctccagaccatttcagtccattattcatgccaaaaggacctacagagaactg cggttacttaaacatatgaaacatgaaaatgtgattggtctgttggatgtttttacacct gcaaggtctctggaggaattcaatgatgtgtatctggtgacccatctcatgggagcagat ctgaacaacattgtgaaatgtcagaagcttacagatgaccatgttcagttcctcatctac cagattctccgaggtctcaagtatatacattcagctgacataattcacagggacctaaaa cctagtaatctagctgtgaatgaagactgtgagctgaagatcttggattttggactggcc cgacatacagatgatgaaatgacaggctatgtggccaccaggtggtacagggctcctgag atcatgctgaactggatgcattacaaccagacagttgatatttggtcagtgggatgcata atggccgagctgttgactggaagaacgttgtttcctggtacagaccatattgatcagttg aagctcattttaagactcgttggaaccccaggggctgatcttttgaagaaaatctcttca gagtctgcaagaaattacattcagtctttgacccagatgccgaaaatgaactttgcaaat gtatttattggtgccaatcccttggctgtcgacttgctggagaagatgcttgtattggac tcagacaagagaattacggcagcccaagcgctcgcacacgcctactttgctcagtaccac gatcctgatgatgaaccagtggctgatccttacgatcagtcctttgaaagcagggacctc cttatagatgaatggaaaagcctgacctacgatgaagtcatcagctttgtgccaccaccc cttgaccaagaagagatggaatcctga

Ursus maritimus (polar bear): 103665538 Help Entry 103665538         CDS       T03271                                  Gene name MAPK13 Definition (RefSeq) mitogen-activated protein kinase 13   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism umr  Ursus maritimus (polar bear) Pathway umr01522   Endocrine resistance umr04010   MAPK signaling pathway umr04015   Rap1 signaling pathway umr04068   FoxO signaling pathway umr04071   Sphingolipid signaling pathway umr04114   Oocyte meiosis umr04218   Cellular senescence umr04261   Adrenergic signaling in cardiomyocytes umr04370   VEGF signaling pathway umr04380   Osteoclast differentiation umr04550   Signaling pathways regulating pluripotency of stem cells umr04611   Platelet activation umr04613   Neutrophil extracellular trap formation umr04620   Toll-like receptor signaling pathway umr04621   NOD-like receptor signaling pathway umr04622   RIG-I-like receptor signaling pathway umr04625   C-type lectin receptor signaling pathway umr04657   IL-17 signaling pathway umr04658   Th1 and Th2 cell differentiation umr04659   Th17 cell differentiation umr04660   T cell receptor signaling pathway umr04664   Fc epsilon RI signaling pathway umr04668   TNF signaling pathway umr04670   Leukocyte transendothelial migration umr04714   Thermogenesis umr04722   Neurotrophin signaling pathway umr04723   Retrograde endocannabinoid signaling umr04728   Dopaminergic synapse umr04750   Inflammatory mediator regulation of TRP channels umr04912   GnRH signaling pathway umr04914   Progesterone-mediated oocyte maturation umr04917   Prolactin signaling pathway umr04926   Relaxin signaling pathway umr04933   AGE-RAGE signaling pathway in diabetic complications umr04935   Growth hormone synthesis, secretion and action umr05014   Amyotrophic lateral sclerosis umr05020   Prion disease umr05022   Pathways of neurodegeneration - multiple diseases umr05132   Salmonella infection umr05133   Pertussis umr05135   Yersinia infection umr05140   Leishmaniasis umr05142   Chagas disease umr05145   Toxoplasmosis umr05152   Tuberculosis umr05161   Hepatitis B umr05163   Human cytomegalovirus infection umr05167   Kaposi sarcoma-associated herpesvirus infection umr05169   Epstein-Barr virus infection umr05170   Human immunodeficiency virus 1 infection umr05171   Coronavirus disease - COVID-19 umr05205   Proteoglycans in cancer umr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer umr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103665538 (MAPK13)    04015 Rap1 signaling pathway     103665538 (MAPK13)    04370 VEGF signaling pathway     103665538 (MAPK13)    04668 TNF signaling pathway     103665538 (MAPK13)    04068 FoxO signaling pathway     103665538 (MAPK13)    04071 Sphingolipid signaling pathway     103665538 (MAPK13)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     103665538 (MAPK13)    04218 Cellular senescence     103665538 (MAPK13)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     103665538 (MAPK13)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103665538 (MAPK13)    04613 Neutrophil extracellular trap formation     103665538 (MAPK13)    04620 Toll-like receptor signaling pathway     103665538 (MAPK13)    04621 NOD-like receptor signaling pathway     103665538 (MAPK13)    04622 RIG-I-like receptor signaling pathway     103665538 (MAPK13)    04625 C-type lectin receptor signaling pathway     103665538 (MAPK13)    04660 T cell receptor signaling pathway     103665538 (MAPK13)    04658 Th1 and Th2 cell differentiation     103665538 (MAPK13)    04659 Th17 cell differentiation     103665538 (MAPK13)    04657 IL-17 signaling pathway     103665538 (MAPK13)    04664 Fc epsilon RI signaling pathway     103665538 (MAPK13)    04670 Leukocyte transendothelial migration     103665538 (MAPK13)   09152 Endocrine system    04912 GnRH signaling pathway     103665538 (MAPK13)    04914 Progesterone-mediated oocyte maturation     103665538 (MAPK13)    04917 Prolactin signaling pathway     103665538 (MAPK13)    04926 Relaxin signaling pathway     103665538 (MAPK13)    04935 Growth hormone synthesis, secretion and action     103665538 (MAPK13)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     103665538 (MAPK13)   09156 Nervous system    04728 Dopaminergic synapse     103665538 (MAPK13)    04723 Retrograde endocannabinoid signaling     103665538 (MAPK13)    04722 Neurotrophin signaling pathway     103665538 (MAPK13)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     103665538 (MAPK13)   09158 Development and regeneration    04380 Osteoclast differentiation     103665538 (MAPK13)   09159 Environmental adaptation    04714 Thermogenesis     103665538 (MAPK13)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     103665538 (MAPK13)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103665538 (MAPK13)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103665538 (MAPK13)    05020 Prion disease     103665538 (MAPK13)    05022 Pathways of neurodegeneration - multiple diseases     103665538 (MAPK13)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103665538 (MAPK13)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103665538 (MAPK13)   09171 Infectious disease: bacterial    05132 Salmonella infection     103665538 (MAPK13)    05135 Yersinia infection     103665538 (MAPK13)    05133 Pertussis     103665538 (MAPK13)    05152 Tuberculosis     103665538 (MAPK13)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103665538 (MAPK13)    05161 Hepatitis B     103665538 (MAPK13)    05171 Coronavirus disease - COVID-19     103665538 (MAPK13)    05163 Human cytomegalovirus infection     103665538 (MAPK13)    05167 Kaposi sarcoma-associated herpesvirus infection     103665538 (MAPK13)    05169 Epstein-Barr virus infection     103665538 (MAPK13)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103665538 (MAPK13)    05140 Leishmaniasis     103665538 (MAPK13)    05142 Chagas disease     103665538 (MAPK13)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     103665538 (MAPK13)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:umr01001]     103665538 (MAPK13) Enzymes [BR:umr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      103665538 (MAPK13) Protein kinases [BR:umr01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    103665538 (MAPK13) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH RIO1 Kinase-like DUF4023 Motif Other DBs NCBI-GeneID:  103665538 NCBI-ProteinID:  XP_008691707 UniProt:  A0A384CA72 LinkDB All DBs Position Un AA seq 439 aa AA seqDB search MSSGQRLGGGEQTRLELKGKRSLELVEGSTRDVLSDPLGFLSHASEGSECGVGAAGEESK PQPADLCVPSSSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELRLLKHIRRLGACLLPQ TVYQERVGGGVHGWGPKGKGARAVAAAPPHWQPSPQVIGLLDVFTPASSLRSFHDFYLVM PFMQTDLQKIMGMEFSEDKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKIL DFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKD YLDQLSQILKVTGVPGAEFVQKLHDKAAKSYIQALPQSPKKDFSQLFPRASPQAIDVLEK MLELDVDKRLTASQALAHPFFELFRDPEEETEAPQPFDDSLEHEKLTVDEWKQHIYKEIV NFSPVARKDSRRRSGMKLQ NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgggccagcgtctgggaggaggagagcagacgagattggagctgaaggggaag aggagcctggagctagtggaggggagcaccagggacgtcctcagtgaccccctgggcttc ctctcccatgccagtgaagggtcagaatgtggcgtgggggctgctggggaggaaagcaag ccccagcccgccgacctgtgcgtgccctccagctccgccatcgacaagcggtcaggggag aaggtggccatcaagaagctgagccggcccttccagtccgagatcttcgccaagcgggcc taccgagagctgcggctgctgaagcacatcagaaggctgggagcctgcctcctgccccag acggtgtatcaggaaagggtgggtggtggtgtgcatggctggggccccaagggaaagggg gcgagggctgtggcggccgccccgcctcactggcaaccttctccccaggtcatcgggctc ctggatgtcttcaccccagcctcctccctgcgcagcttccatgacttctacctggtgatg cccttcatgcagacggacctgcagaagatcatggggatggagttcagcgaggacaagatc cagtacctggtgtatcagatgcttaaggggctcaagtacatccactcagctggggtcgtc cacagggacctaaagccgggcaacctggctgtgaacgaggactgcgagctgaagatcttg gatttcggcctggcccggcacgcggacgcggagatgacgggctacgtggtgacccgctgg taccgggcccccgaggtgatcctcagctggatgcactacaaccagaccgtggacatctgg tctgtgggctgtatcatggcagagatgctgacggggaagactctgttcaaggggaaagat tacctggaccagctgtcccagatcctgaaagtgaccggggtgccgggcgcagagtttgtg cagaagttgcacgacaaagcagccaaatcctacatccaggccctgccacagagccccaag aaggatttctctcagctcttcccgcgcgccagcccccaggccatagacgtgctggagaag atgctggagctggacgtggacaagcgcctgacggcctcgcaggccctcgcgcaccccttc tttgaactcttccgagacccggaggaggagacagaggccccgcagccttttgatgattcc ctggaacatgagaaactcacagtggatgaatggaagcagcacatctacaaggagatcgtg aacttcagccccgttgcccggaaggactcacggcgccggagcggcatgaagctgcagtga

Ursus maritimus (polar bear): 103674115 Help Entry 103674115         CDS       T03271                                  Gene name MAPK12 Definition (RefSeq) mitogen-activated protein kinase 12   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism umr  Ursus maritimus (polar bear) Pathway umr01522   Endocrine resistance umr04010   MAPK signaling pathway umr04015   Rap1 signaling pathway umr04068   FoxO signaling pathway umr04071   Sphingolipid signaling pathway umr04114   Oocyte meiosis umr04218   Cellular senescence umr04261   Adrenergic signaling in cardiomyocytes umr04370   VEGF signaling pathway umr04380   Osteoclast differentiation umr04550   Signaling pathways regulating pluripotency of stem cells umr04611   Platelet activation umr04613   Neutrophil extracellular trap formation umr04620   Toll-like receptor signaling pathway umr04621   NOD-like receptor signaling pathway umr04622   RIG-I-like receptor signaling pathway umr04625   C-type lectin receptor signaling pathway umr04657   IL-17 signaling pathway umr04658   Th1 and Th2 cell differentiation umr04659   Th17 cell differentiation umr04660   T cell receptor signaling pathway umr04664   Fc epsilon RI signaling pathway umr04668   TNF signaling pathway umr04670   Leukocyte transendothelial migration umr04714   Thermogenesis umr04722   Neurotrophin signaling pathway umr04723   Retrograde endocannabinoid signaling umr04728   Dopaminergic synapse umr04750   Inflammatory mediator regulation of TRP channels umr04912   GnRH signaling pathway umr04914   Progesterone-mediated oocyte maturation umr04917   Prolactin signaling pathway umr04926   Relaxin signaling pathway umr04933   AGE-RAGE signaling pathway in diabetic complications umr04935   Growth hormone synthesis, secretion and action umr05014   Amyotrophic lateral sclerosis umr05020   Prion disease umr05022   Pathways of neurodegeneration - multiple diseases umr05132   Salmonella infection umr05133   Pertussis umr05135   Yersinia infection umr05140   Leishmaniasis umr05142   Chagas disease umr05145   Toxoplasmosis umr05152   Tuberculosis umr05161   Hepatitis B umr05163   Human cytomegalovirus infection umr05167   Kaposi sarcoma-associated herpesvirus infection umr05169   Epstein-Barr virus infection umr05170   Human immunodeficiency virus 1 infection umr05171   Coronavirus disease - COVID-19 umr05205   Proteoglycans in cancer umr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer umr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103674115 (MAPK12)    04015 Rap1 signaling pathway     103674115 (MAPK12)    04370 VEGF signaling pathway     103674115 (MAPK12)    04668 TNF signaling pathway     103674115 (MAPK12)    04068 FoxO signaling pathway     103674115 (MAPK12)    04071 Sphingolipid signaling pathway     103674115 (MAPK12)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     103674115 (MAPK12)    04218 Cellular senescence     103674115 (MAPK12)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     103674115 (MAPK12)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103674115 (MAPK12)    04613 Neutrophil extracellular trap formation     103674115 (MAPK12)    04620 Toll-like receptor signaling pathway     103674115 (MAPK12)    04621 NOD-like receptor signaling pathway     103674115 (MAPK12)    04622 RIG-I-like receptor signaling pathway     103674115 (MAPK12)    04625 C-type lectin receptor signaling pathway     103674115 (MAPK12)    04660 T cell receptor signaling pathway     103674115 (MAPK12)    04658 Th1 and Th2 cell differentiation     103674115 (MAPK12)    04659 Th17 cell differentiation     103674115 (MAPK12)    04657 IL-17 signaling pathway     103674115 (MAPK12)    04664 Fc epsilon RI signaling pathway     103674115 (MAPK12)    04670 Leukocyte transendothelial migration     103674115 (MAPK12)   09152 Endocrine system    04912 GnRH signaling pathway     103674115 (MAPK12)    04914 Progesterone-mediated oocyte maturation     103674115 (MAPK12)    04917 Prolactin signaling pathway     103674115 (MAPK12)    04926 Relaxin signaling pathway     103674115 (MAPK12)    04935 Growth hormone synthesis, secretion and action     103674115 (MAPK12)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     103674115 (MAPK12)   09156 Nervous system    04728 Dopaminergic synapse     103674115 (MAPK12)    04723 Retrograde endocannabinoid signaling     103674115 (MAPK12)    04722 Neurotrophin signaling pathway     103674115 (MAPK12)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     103674115 (MAPK12)   09158 Development and regeneration    04380 Osteoclast differentiation     103674115 (MAPK12)   09159 Environmental adaptation    04714 Thermogenesis     103674115 (MAPK12)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     103674115 (MAPK12)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103674115 (MAPK12)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103674115 (MAPK12)    05020 Prion disease     103674115 (MAPK12)    05022 Pathways of neurodegeneration - multiple diseases     103674115 (MAPK12)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103674115 (MAPK12)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103674115 (MAPK12)   09171 Infectious disease: bacterial    05132 Salmonella infection     103674115 (MAPK12)    05135 Yersinia infection     103674115 (MAPK12)    05133 Pertussis     103674115 (MAPK12)    05152 Tuberculosis     103674115 (MAPK12)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103674115 (MAPK12)    05161 Hepatitis B     103674115 (MAPK12)    05171 Coronavirus disease - COVID-19     103674115 (MAPK12)    05163 Human cytomegalovirus infection     103674115 (MAPK12)    05167 Kaposi sarcoma-associated herpesvirus infection     103674115 (MAPK12)    05169 Epstein-Barr virus infection     103674115 (MAPK12)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103674115 (MAPK12)    05140 Leishmaniasis     103674115 (MAPK12)    05142 Chagas disease     103674115 (MAPK12)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     103674115 (MAPK12)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:umr01001]     103674115 (MAPK12) Enzymes [BR:umr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      103674115 (MAPK12) Protein kinases [BR:umr01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    103674115 (MAPK12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo UvrD_C Kinase-like Motif Other DBs NCBI-GeneID:  103674115 NCBI-ProteinID:  XP_008701202 UniProt:  A0A384D2A0 LinkDB All DBs Position Un AA seq 327 aa AA seqDB search MAQPQGKGETCKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLD DFTDFYLVMPFMGTDLGKLMKHEKLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLA VNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSAGCIMAEMI TGKTLFKGSDHLDQLKEIMKVTGTPPADFVQRLQSADAKNYMKGLPELEKKDFASILTSA SPLAVNLLEKMLVLDAERRVTAAEALTHPYFESLHDTEDEPKAQKYDESFDDMDRTLDEW KRVTYKEVLSFKPPLQLGTKVSKETAL NT seq 984 nt NT seq  +upstreamnt  +downstreamnt atggctcagccccaggggaaaggggagacctgcaaggtggccatcaagaagctgtaccgg cccttccagtcggagctcttcgccaagcgcgcctaccgcgagctgcgtctgctcaagcac atgcgccacgagaacgtcatcgggctgctggacgtgttcactcctgatgaaaccttggat gatttcacagacttttacctggtgatgccgttcatggggactgacctaggaaagctcatg aagcacgagaaactgagcgaggaccgaatccagttccttgtctaccagatgttgaagggg ctaaagtacattcacgctgctggcgtcatccacagggacctgaagcctggcaacctggcc gtgaatgaggactgtgagctgaagattctggacttcggcctggcgaggcaggcggacagc gagatgactgggtatgtggtgacccggtggtaccgggcgcccgaggtcatcttgaactgg atgcgttacacgcagacagtggacatctggtcagcgggctgcatcatggcggagatgatc acggggaagacgctgtttaagggcagtgaccacctggaccagctgaaggagatcatgaag gtgacagggacgcctcccgctgactttgtgcagaggctgcagagtgcggacgcgaagaac tacatgaagggcctccccgagttggagaagaaggattttgcctccatcctgactagtgca agccctctggctgtgaacctcctggagaaaatgctggtgctagatgcagagcggcgggtg acggcggccgaggcgctgacccacccctacttcgagtcactgcatgacacggaggatgag cccaaggcccagaagtacgatgagtcctttgatgatatggaccgcacgctggacgagtgg aaacgtgtcacatataaagaagtgctcagcttcaagcctcccctgcagctggggaccaag gtctccaaggagacggctctgtga

DBGET integrated database retrieval system