KEGG   Ursus maritimus (polar bear): 103665451
Entry
103665451         CDS       T03271                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04015  Rap1 signaling pathway
umr04068  FoxO signaling pathway
umr04071  Sphingolipid signaling pathway
umr04114  Oocyte meiosis
umr04218  Cellular senescence
umr04261  Adrenergic signaling in cardiomyocytes
umr04370  VEGF signaling pathway
umr04380  Osteoclast differentiation
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04611  Platelet activation
umr04613  Neutrophil extracellular trap formation
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04657  IL-17 signaling pathway
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04668  TNF signaling pathway
umr04670  Leukocyte transendothelial migration
umr04714  Thermogenesis
umr04722  Neurotrophin signaling pathway
umr04723  Retrograde endocannabinoid signaling
umr04728  Dopaminergic synapse
umr04750  Inflammatory mediator regulation of TRP channels
umr04912  GnRH signaling pathway
umr04914  Progesterone-mediated oocyte maturation
umr04917  Prolactin signaling pathway
umr04926  Relaxin signaling pathway
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr05014  Amyotrophic lateral sclerosis
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05132  Salmonella infection
umr05133  Pertussis
umr05135  Yersinia infection
umr05140  Leishmaniasis
umr05142  Chagas disease
umr05145  Toxoplasmosis
umr05152  Tuberculosis
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05205  Proteoglycans in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103665451 (MAPK14)
   04015 Rap1 signaling pathway
    103665451 (MAPK14)
   04370 VEGF signaling pathway
    103665451 (MAPK14)
   04668 TNF signaling pathway
    103665451 (MAPK14)
   04068 FoxO signaling pathway
    103665451 (MAPK14)
   04071 Sphingolipid signaling pathway
    103665451 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103665451 (MAPK14)
   04218 Cellular senescence
    103665451 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103665451 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103665451 (MAPK14)
   04613 Neutrophil extracellular trap formation
    103665451 (MAPK14)
   04620 Toll-like receptor signaling pathway
    103665451 (MAPK14)
   04621 NOD-like receptor signaling pathway
    103665451 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    103665451 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    103665451 (MAPK14)
   04660 T cell receptor signaling pathway
    103665451 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    103665451 (MAPK14)
   04659 Th17 cell differentiation
    103665451 (MAPK14)
   04657 IL-17 signaling pathway
    103665451 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    103665451 (MAPK14)
   04670 Leukocyte transendothelial migration
    103665451 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103665451 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    103665451 (MAPK14)
   04917 Prolactin signaling pathway
    103665451 (MAPK14)
   04926 Relaxin signaling pathway
    103665451 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    103665451 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103665451 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    103665451 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    103665451 (MAPK14)
   04722 Neurotrophin signaling pathway
    103665451 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103665451 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103665451 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    103665451 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103665451 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103665451 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103665451 (MAPK14)
   05020 Prion disease
    103665451 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    103665451 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103665451 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103665451 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103665451 (MAPK14)
   05135 Yersinia infection
    103665451 (MAPK14)
   05133 Pertussis
    103665451 (MAPK14)
   05152 Tuberculosis
    103665451 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103665451 (MAPK14)
   05161 Hepatitis B
    103665451 (MAPK14)
   05171 Coronavirus disease - COVID-19
    103665451 (MAPK14)
   05163 Human cytomegalovirus infection
    103665451 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103665451 (MAPK14)
   05169 Epstein-Barr virus infection
    103665451 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103665451 (MAPK14)
   05140 Leishmaniasis
    103665451 (MAPK14)
   05142 Chagas disease
    103665451 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103665451 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103665451 (MAPK14)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103665451 (MAPK14)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103665451 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 103665451
NCBI-ProteinID: XP_008691617
UniProt: A0A384C9Y1
LinkDB
Position
Un
AA seq 368 aa
FAGSGTATTGTSAGAAAGAEQKKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAV
KKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGAD
LNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLA
RHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQL
KLILRLVGTPGADLLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLD
SDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
LDQEEMES
NT seq 1107 nt   +upstreamnt  +downstreamnt
ttcgctggctctggaacggcgaccactggaacctcagcgggcgctgcagctggagcggag
cagaaaaagacaatctgggaggtgcccgagcgttaccagaatctgtccccggtgggctcc
ggtgcctatggctccgtgtgtgctgcttttgacacaaaaactgggttacgtgtggcagtg
aagaagctctccagaccatttcagtccattattcatgccaaaaggacctacagagaactg
cggttacttaaacatatgaaacatgaaaatgtgattggtctgttggatgtttttacacct
gcaaggtctctggaggaattcaatgatgtgtatctggtgacccatctcatgggagcagat
ctgaacaacattgtgaaatgtcagaagcttacagatgaccatgttcagttcctcatctac
cagattctccgaggtctcaagtatatacattcagctgacataattcacagggacctaaaa
cctagtaatctagctgtgaatgaagactgtgagctgaagatcttggattttggactggcc
cgacatacagatgatgaaatgacaggctatgtggccaccaggtggtacagggctcctgag
atcatgctgaactggatgcattacaaccagacagttgatatttggtcagtgggatgcata
atggccgagctgttgactggaagaacgttgtttcctggtacagaccatattgatcagttg
aagctcattttaagactcgttggaaccccaggggctgatcttttgaagaaaatctcttca
gagtctgcaagaaattacattcagtctttgacccagatgccgaaaatgaactttgcaaat
gtatttattggtgccaatcccttggctgtcgacttgctggagaagatgcttgtattggac
tcagacaagagaattacggcagcccaagcgctcgcacacgcctactttgctcagtaccac
gatcctgatgatgaaccagtggctgatccttacgatcagtcctttgaaagcagggacctc
cttatagatgaatggaaaagcctgacctacgatgaagtcatcagctttgtgccaccaccc
cttgaccaagaagagatggaatcctga

KEGG   Ursus maritimus (polar bear): 103665538
Entry
103665538         CDS       T03271                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04015  Rap1 signaling pathway
umr04068  FoxO signaling pathway
umr04071  Sphingolipid signaling pathway
umr04114  Oocyte meiosis
umr04218  Cellular senescence
umr04261  Adrenergic signaling in cardiomyocytes
umr04370  VEGF signaling pathway
umr04380  Osteoclast differentiation
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04611  Platelet activation
umr04613  Neutrophil extracellular trap formation
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04657  IL-17 signaling pathway
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04668  TNF signaling pathway
umr04670  Leukocyte transendothelial migration
umr04714  Thermogenesis
umr04722  Neurotrophin signaling pathway
umr04723  Retrograde endocannabinoid signaling
umr04728  Dopaminergic synapse
umr04750  Inflammatory mediator regulation of TRP channels
umr04912  GnRH signaling pathway
umr04914  Progesterone-mediated oocyte maturation
umr04917  Prolactin signaling pathway
umr04926  Relaxin signaling pathway
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr05014  Amyotrophic lateral sclerosis
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05132  Salmonella infection
umr05133  Pertussis
umr05135  Yersinia infection
umr05140  Leishmaniasis
umr05142  Chagas disease
umr05145  Toxoplasmosis
umr05152  Tuberculosis
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05205  Proteoglycans in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103665538 (MAPK13)
   04015 Rap1 signaling pathway
    103665538 (MAPK13)
   04370 VEGF signaling pathway
    103665538 (MAPK13)
   04668 TNF signaling pathway
    103665538 (MAPK13)
   04068 FoxO signaling pathway
    103665538 (MAPK13)
   04071 Sphingolipid signaling pathway
    103665538 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103665538 (MAPK13)
   04218 Cellular senescence
    103665538 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103665538 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103665538 (MAPK13)
   04613 Neutrophil extracellular trap formation
    103665538 (MAPK13)
   04620 Toll-like receptor signaling pathway
    103665538 (MAPK13)
   04621 NOD-like receptor signaling pathway
    103665538 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    103665538 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    103665538 (MAPK13)
   04660 T cell receptor signaling pathway
    103665538 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    103665538 (MAPK13)
   04659 Th17 cell differentiation
    103665538 (MAPK13)
   04657 IL-17 signaling pathway
    103665538 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    103665538 (MAPK13)
   04670 Leukocyte transendothelial migration
    103665538 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103665538 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    103665538 (MAPK13)
   04917 Prolactin signaling pathway
    103665538 (MAPK13)
   04926 Relaxin signaling pathway
    103665538 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    103665538 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103665538 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    103665538 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    103665538 (MAPK13)
   04722 Neurotrophin signaling pathway
    103665538 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103665538 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103665538 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    103665538 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103665538 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103665538 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103665538 (MAPK13)
   05020 Prion disease
    103665538 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    103665538 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103665538 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103665538 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103665538 (MAPK13)
   05135 Yersinia infection
    103665538 (MAPK13)
   05133 Pertussis
    103665538 (MAPK13)
   05152 Tuberculosis
    103665538 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103665538 (MAPK13)
   05161 Hepatitis B
    103665538 (MAPK13)
   05171 Coronavirus disease - COVID-19
    103665538 (MAPK13)
   05163 Human cytomegalovirus infection
    103665538 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103665538 (MAPK13)
   05169 Epstein-Barr virus infection
    103665538 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103665538 (MAPK13)
   05140 Leishmaniasis
    103665538 (MAPK13)
   05142 Chagas disease
    103665538 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103665538 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103665538 (MAPK13)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103665538 (MAPK13)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103665538 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH RIO1 Kinase-like DUF4023
Other DBs
NCBI-GeneID: 103665538
NCBI-ProteinID: XP_008691707
UniProt: A0A384CA72
LinkDB
Position
Un
AA seq 439 aa
MSSGQRLGGGEQTRLELKGKRSLELVEGSTRDVLSDPLGFLSHASEGSECGVGAAGEESK
PQPADLCVPSSSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELRLLKHIRRLGACLLPQ
TVYQERVGGGVHGWGPKGKGARAVAAAPPHWQPSPQVIGLLDVFTPASSLRSFHDFYLVM
PFMQTDLQKIMGMEFSEDKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKIL
DFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKD
YLDQLSQILKVTGVPGAEFVQKLHDKAAKSYIQALPQSPKKDFSQLFPRASPQAIDVLEK
MLELDVDKRLTASQALAHPFFELFRDPEEETEAPQPFDDSLEHEKLTVDEWKQHIYKEIV
NFSPVARKDSRRRSGMKLQ
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgtcgtcgggccagcgtctgggaggaggagagcagacgagattggagctgaaggggaag
aggagcctggagctagtggaggggagcaccagggacgtcctcagtgaccccctgggcttc
ctctcccatgccagtgaagggtcagaatgtggcgtgggggctgctggggaggaaagcaag
ccccagcccgccgacctgtgcgtgccctccagctccgccatcgacaagcggtcaggggag
aaggtggccatcaagaagctgagccggcccttccagtccgagatcttcgccaagcgggcc
taccgagagctgcggctgctgaagcacatcagaaggctgggagcctgcctcctgccccag
acggtgtatcaggaaagggtgggtggtggtgtgcatggctggggccccaagggaaagggg
gcgagggctgtggcggccgccccgcctcactggcaaccttctccccaggtcatcgggctc
ctggatgtcttcaccccagcctcctccctgcgcagcttccatgacttctacctggtgatg
cccttcatgcagacggacctgcagaagatcatggggatggagttcagcgaggacaagatc
cagtacctggtgtatcagatgcttaaggggctcaagtacatccactcagctggggtcgtc
cacagggacctaaagccgggcaacctggctgtgaacgaggactgcgagctgaagatcttg
gatttcggcctggcccggcacgcggacgcggagatgacgggctacgtggtgacccgctgg
taccgggcccccgaggtgatcctcagctggatgcactacaaccagaccgtggacatctgg
tctgtgggctgtatcatggcagagatgctgacggggaagactctgttcaaggggaaagat
tacctggaccagctgtcccagatcctgaaagtgaccggggtgccgggcgcagagtttgtg
cagaagttgcacgacaaagcagccaaatcctacatccaggccctgccacagagccccaag
aaggatttctctcagctcttcccgcgcgccagcccccaggccatagacgtgctggagaag
atgctggagctggacgtggacaagcgcctgacggcctcgcaggccctcgcgcaccccttc
tttgaactcttccgagacccggaggaggagacagaggccccgcagccttttgatgattcc
ctggaacatgagaaactcacagtggatgaatggaagcagcacatctacaaggagatcgtg
aacttcagccccgttgcccggaaggactcacggcgccggagcggcatgaagctgcagtga

KEGG   Ursus maritimus (polar bear): 103674115
Entry
103674115         CDS       T03271                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04015  Rap1 signaling pathway
umr04068  FoxO signaling pathway
umr04071  Sphingolipid signaling pathway
umr04114  Oocyte meiosis
umr04218  Cellular senescence
umr04261  Adrenergic signaling in cardiomyocytes
umr04370  VEGF signaling pathway
umr04380  Osteoclast differentiation
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04611  Platelet activation
umr04613  Neutrophil extracellular trap formation
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04657  IL-17 signaling pathway
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04668  TNF signaling pathway
umr04670  Leukocyte transendothelial migration
umr04714  Thermogenesis
umr04722  Neurotrophin signaling pathway
umr04723  Retrograde endocannabinoid signaling
umr04728  Dopaminergic synapse
umr04750  Inflammatory mediator regulation of TRP channels
umr04912  GnRH signaling pathway
umr04914  Progesterone-mediated oocyte maturation
umr04917  Prolactin signaling pathway
umr04926  Relaxin signaling pathway
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr05014  Amyotrophic lateral sclerosis
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05132  Salmonella infection
umr05133  Pertussis
umr05135  Yersinia infection
umr05140  Leishmaniasis
umr05142  Chagas disease
umr05145  Toxoplasmosis
umr05152  Tuberculosis
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05205  Proteoglycans in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103674115 (MAPK12)
   04015 Rap1 signaling pathway
    103674115 (MAPK12)
   04370 VEGF signaling pathway
    103674115 (MAPK12)
   04668 TNF signaling pathway
    103674115 (MAPK12)
   04068 FoxO signaling pathway
    103674115 (MAPK12)
   04071 Sphingolipid signaling pathway
    103674115 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103674115 (MAPK12)
   04218 Cellular senescence
    103674115 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103674115 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103674115 (MAPK12)
   04613 Neutrophil extracellular trap formation
    103674115 (MAPK12)
   04620 Toll-like receptor signaling pathway
    103674115 (MAPK12)
   04621 NOD-like receptor signaling pathway
    103674115 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    103674115 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    103674115 (MAPK12)
   04660 T cell receptor signaling pathway
    103674115 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    103674115 (MAPK12)
   04659 Th17 cell differentiation
    103674115 (MAPK12)
   04657 IL-17 signaling pathway
    103674115 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    103674115 (MAPK12)
   04670 Leukocyte transendothelial migration
    103674115 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103674115 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    103674115 (MAPK12)
   04917 Prolactin signaling pathway
    103674115 (MAPK12)
   04926 Relaxin signaling pathway
    103674115 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    103674115 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103674115 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    103674115 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    103674115 (MAPK12)
   04722 Neurotrophin signaling pathway
    103674115 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103674115 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103674115 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    103674115 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103674115 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103674115 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103674115 (MAPK12)
   05020 Prion disease
    103674115 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    103674115 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103674115 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103674115 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103674115 (MAPK12)
   05135 Yersinia infection
    103674115 (MAPK12)
   05133 Pertussis
    103674115 (MAPK12)
   05152 Tuberculosis
    103674115 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103674115 (MAPK12)
   05161 Hepatitis B
    103674115 (MAPK12)
   05171 Coronavirus disease - COVID-19
    103674115 (MAPK12)
   05163 Human cytomegalovirus infection
    103674115 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103674115 (MAPK12)
   05169 Epstein-Barr virus infection
    103674115 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103674115 (MAPK12)
   05140 Leishmaniasis
    103674115 (MAPK12)
   05142 Chagas disease
    103674115 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103674115 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103674115 (MAPK12)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103674115 (MAPK12)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103674115 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo UvrD_C Kinase-like
Other DBs
NCBI-GeneID: 103674115
NCBI-ProteinID: XP_008701202
UniProt: A0A384D2A0
LinkDB
Position
Un
AA seq 327 aa
MAQPQGKGETCKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLD
DFTDFYLVMPFMGTDLGKLMKHEKLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLA
VNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSAGCIMAEMI
TGKTLFKGSDHLDQLKEIMKVTGTPPADFVQRLQSADAKNYMKGLPELEKKDFASILTSA
SPLAVNLLEKMLVLDAERRVTAAEALTHPYFESLHDTEDEPKAQKYDESFDDMDRTLDEW
KRVTYKEVLSFKPPLQLGTKVSKETAL
NT seq 984 nt   +upstreamnt  +downstreamnt
atggctcagccccaggggaaaggggagacctgcaaggtggccatcaagaagctgtaccgg
cccttccagtcggagctcttcgccaagcgcgcctaccgcgagctgcgtctgctcaagcac
atgcgccacgagaacgtcatcgggctgctggacgtgttcactcctgatgaaaccttggat
gatttcacagacttttacctggtgatgccgttcatggggactgacctaggaaagctcatg
aagcacgagaaactgagcgaggaccgaatccagttccttgtctaccagatgttgaagggg
ctaaagtacattcacgctgctggcgtcatccacagggacctgaagcctggcaacctggcc
gtgaatgaggactgtgagctgaagattctggacttcggcctggcgaggcaggcggacagc
gagatgactgggtatgtggtgacccggtggtaccgggcgcccgaggtcatcttgaactgg
atgcgttacacgcagacagtggacatctggtcagcgggctgcatcatggcggagatgatc
acggggaagacgctgtttaagggcagtgaccacctggaccagctgaaggagatcatgaag
gtgacagggacgcctcccgctgactttgtgcagaggctgcagagtgcggacgcgaagaac
tacatgaagggcctccccgagttggagaagaaggattttgcctccatcctgactagtgca
agccctctggctgtgaacctcctggagaaaatgctggtgctagatgcagagcggcgggtg
acggcggccgaggcgctgacccacccctacttcgagtcactgcatgacacggaggatgag
cccaaggcccagaagtacgatgagtcctttgatgatatggaccgcacgctggacgagtgg
aaacgtgtcacatataaagaagtgctcagcttcaagcctcccctgcagctggggaccaag
gtctccaaggagacggctctgtga

DBGET integrated database retrieval system