KEGG   Ursus maritimus (polar bear): 103665481
Entry
103665481         CDS       T03271                                 

Definition
(RefSeq) putative Bcl-2 homologous antagonist/killer 2
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01524  Platinum drug resistance
umr04141  Protein processing in endoplasmic reticulum
umr04210  Apoptosis
umr04215  Apoptosis - multiple species
umr05022  Pathways of neurodegeneration - multiple diseases
umr05132  Salmonella infection
umr05160  Hepatitis C
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05203  Viral carcinogenesis
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05216  Thyroid cancer
umr05217  Basal cell carcinoma
umr05218  Melanoma
umr05220  Chronic myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103665481
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103665481
   04215 Apoptosis - multiple species
    103665481
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103665481
   05202 Transcriptional misregulation in cancer
    103665481
   05206 MicroRNAs in cancer
    103665481
   05203 Viral carcinogenesis
    103665481
  09162 Cancer: specific types
   05210 Colorectal cancer
    103665481
   05212 Pancreatic cancer
    103665481
   05225 Hepatocellular carcinoma
    103665481
   05226 Gastric cancer
    103665481
   05214 Glioma
    103665481
   05216 Thyroid cancer
    103665481
   05220 Chronic myeloid leukemia
    103665481
   05217 Basal cell carcinoma
    103665481
   05218 Melanoma
    103665481
   05213 Endometrial cancer
    103665481
   05224 Breast cancer
    103665481
   05222 Small cell lung cancer
    103665481
   05223 Non-small cell lung cancer
    103665481
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    103665481
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103665481
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103665481
   05160 Hepatitis C
    103665481
   05164 Influenza A
    103665481
   05162 Measles
    103665481
   05168 Herpes simplex virus 1 infection
    103665481
   05163 Human cytomegalovirus infection
    103665481
   05167 Kaposi sarcoma-associated herpesvirus infection
    103665481
   05169 Epstein-Barr virus infection
    103665481
   05165 Human papillomavirus infection
    103665481
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103665481
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:umr03029]
    103665481
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:umr02000]
    103665481
Mitochondrial biogenesis [BR:umr03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    103665481
Transporters [BR:umr02000]
 Other transporters
  Pores ion channels [TC:1]
   103665481
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 103665481
NCBI-ProteinID: XP_008691643
UniProt: A0A384C9Y3
LinkDB
Position
Un
AA seq 117 aa
MASGQGPGPPRQECGETAPSSTSEEQVARDTEEVFRSYVFYRHRQEQEAEGAAAPADPEM
VSLSLEPSSTMGQVGRQLAIIGDDINQRYDSEFQTMLQHLQPTAENAYEYFTKIASR
NT seq 354 nt   +upstreamnt  +downstreamnt
atggcatccgggcaaggcccaggtcctcccaggcaggagtgtggagagacggccccatct
tctacttctgaggagcaggtagcccgggacaccgaggaggttttccgcagctatgttttt
taccgccatcggcaggagcaggaggctgagggggcggctgcgcctgctgacccagaaatg
gtctccttgtccctagaacctagcagcaccatggggcaggtgggtcggcagctcgccatc
atcggggatgacatcaaccagcgctacgactctgagttccagaccatgctgcagcaccta
cagccaacggcagagaacgcctatgagtacttcaccaagatcgcctcgaggtag

DBGET integrated database retrieval system