KEGG   Ursus maritimus (polar bear): 103665897Help
Entry
103665897         CDS       T03271                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04614  Renin-angiotensin system
umr04924  Renin secretion
umr05142  Chagas disease (American trypanosomiasis)
umr05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:umr00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    103665897
   04614 Renin-angiotensin system
    103665897
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    103665897
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    103665897
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:umr01002]
    103665897
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103665897
   04090 CD Molecules [BR:umr04090]
    103665897
Enzymes [BR:umr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     103665897
Peptidases [BR:umr01002]
 Metallo Peptidases
  Family M2
   103665897
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103665897
CD molecules [BR:umr04090]
 Proteins
  103665897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Mtc
Motif
Other DBs
NCBI-GeneID: 103665897
NCBI-ProteinID: XP_008692154
LinkDB All DBs
Position
Un
AA seq 764 aa AA seqDB search
MELDRDWSIASPSSAVLLAMGTRWTCHGPSLFVLFCYGQLLPWLRTEGDQSLDKFYNETV
AKAFLQFYEHTAQVVWNQFMEATWNYVTNITNKNREEMLHKDSERSQHMLYFGTRARLFK
TSRFQDPAVKRMLSKLQNIDKAALPQDELREYNKLLAYMETTYSTAQVCLNEGPCLPMEP
DLQEIMATSRDQKELLWAWQGWRDAVGRQLRITFERYVQLSNKAAKLNGYKDMGALWRSQ
YESDTLEQDLEQLYQELQPLYLNLHAYVRRALHRHYGPQLIDPRGPIPAHLLGNMWAQSW
VNILDLVLPFPKKPPEDITKIMKSQHWKPSKMFEEADMFFTSLGLLSTPPNFWKKSMMER
PTDGREVECHASAWDFYNGKDFRIKKCTEVTIEDLLSIFHQMGHIQYFLQYKNLSVIFRA
GANPAFEEAVGSMITLSASSHKHLLNRGLLSHQHQDSEEEVNFLMGIALEKIAFIPFAYL
MDLFRWKVFDGTIQKDVYNQEWWNLRLKYQGMCPPIPRTEDDFDPGAKFHIPASVPYIRY
FVSLVLQFQLHEALCKASGHMGPLHRCDIYNSKMAGKLLEDILKLGSSKPWPEVLQKITG
QTKVSTKALMPCFKXNVRQGEILGWPDFSCTFEEKDTDKVTFLSLELDPDQAKFGQWVLL
AISLVMFLVALLLARRLYSLEKRSLSQDTNAQDTGSRDSSAPETQPKAYFLGIAMEPRLV
AKRQWILLGLCLILTVCSISLTIRIFTQYYRKPRWMRAEWWSWD
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaccgcgattggtccatagcctcacccagctctgctgttctcttggccatg
ggcacaagatggacttgccatggaccttccctatttgtgctcttctgttatgggcagctc
ttgccatggctcaggaccgagggtgatcagagcttagacaagttctacaatgagaccgtg
gcaaaggcgttcctgcagttttatgagcatacggcccaggttgtgtggaaccagttcatg
gaggccacgtggaactatgtcaccaacatcaccaacaaaaatcgggaggagatgctgcac
aaggactcagagaggtcccagcacatgctgtactttggcacccgggcccgcctgtttaag
acctcccggttccaggacccggccgtgaagcgcatgctgagtaagctgcagaacatagac
aaggcggccctgccccaggacgagctccgggagtacaacaagcttctggcctacatggag
acgacgtacagcacggcccaggtgtgcctgaatgagggaccctgcctgcccatggagcct
gacctccaagaaatcatggccacctcccgggaccagaaagagctgctatgggcctggcag
ggctggcgggatgctgtgggtcgtcagctccgcatcacctttgagcgctacgtgcagctc
agcaacaaggctgcaaagctcaacggttacaaagacatgggggccttgtggcggtcccag
tatgagtctgacacgctagaacaggacctggagcagctctaccaggagctgcagccgctc
tacctgaacctgcatgcctacgtgcgccgcgccctgcaccgccactacgggccccagctt
atcgacccgagggggcccatccccgcccacctgctggggaacatgtgggctcagtcctgg
gtcaacatcttagacctggtcctgcccttcccaaagaagccccctgaagatatcacgaag
atcatgaaaagccagcactggaagccctccaaaatgttcgaagaggcagacatgttcttc
acttccctggggctgctttccacccctcccaacttctggaaaaagtccatgatggaaagg
ccaactgacgggcgggaggtggagtgccacgcctccgcctgggacttttacaacggcaag
gacttcaggataaagaagtgcaccgaggtgaccatagaagacctgctctccatcttccac
cagatgggccatatccagtacttcttgcagtacaagaacctctctgtgatcttccgcgca
ggcgccaacccagccttcgaagaggccgtggggtcgatgatcaccctctcggcctcctcc
cacaagcacctgctcaacagaggcctgctcagccaccagcaccaggactcagaggaggag
gtcaatttcctgatgggcattgccctggagaagatcgccttcatccccttcgcctacctg
atggacctgtttcgctggaaggtctttgatggcaccatccagaaggacgtctacaaccag
gagtggtggaacctcaggttgaaataccagggcatgtgcccccccatccctcggacagag
gatgacttcgatcctggtgccaagttccacatccctgccagcgtgccctacatacggtac
ttcgtcagcctcgtgctccagttccagctccacgaagctttatgcaaggcctcgggtcac
atgggcccactgcaccggtgcgacatctataactccaagatggctgggaagctcctggaa
gatatcctaaagctgggctcaagcaagccctggccagaagtcctgcagaagataaccggg
cagaccaaagtgtctacaaaggccctcatgccctgcttcaaannaaatgtgcggcagggg
gagatcctgggctggccagacttcagctgcacctttgaagaaaaagacacagacaaggtg
acatttctgagtctggagctggaccctgaccaggccaaatttgggcagtgggtgttgctg
gccatcagcttggtcatgttcctggtggccctactgctggcccgcaggttgtactctctg
gaaaaaaggtcactgtcccaggacaccaatgcgcaggacaccggttcacgggactccagt
gcccccgagacacagcccaaagcctacttcctgggcatagccatggagccccgcctagtt
gccaaaagacagtggatccttctgggcctctgcctcatcttgacggtgtgctcaatcagc
ctgaccattcggattttcacgcagtactacaggaagcctcggtggatgagagctgaatgg
tggagctgggactag

DBGET integrated database retrieval system