Ursus maritimus (polar bear): 103665907 Help Entry 103665907         CDS       T03271                                  Gene name PRKCA Definition (RefSeq) protein kinase C alpha   KO K02677   classical protein kinase C alpha type [EC:2.7.11.13] Organism umr  Ursus maritimus (polar bear) Pathway umr01521   EGFR tyrosine kinase inhibitor resistance umr04010   MAPK signaling pathway umr04012   ErbB signaling pathway umr04014   Ras signaling pathway umr04015   Rap1 signaling pathway umr04020   Calcium signaling pathway umr04066   HIF-1 signaling pathway umr04070   Phosphatidylinositol signaling system umr04071   Sphingolipid signaling pathway umr04072   Phospholipase D signaling pathway umr04150   mTOR signaling pathway umr04151   PI3K-Akt signaling pathway umr04261   Adrenergic signaling in cardiomyocytes umr04270   Vascular smooth muscle contraction umr04310   Wnt signaling pathway umr04360   Axon guidance umr04370   VEGF signaling pathway umr04510   Focal adhesion umr04540   Gap junction umr04613   Neutrophil extracellular trap formation umr04650   Natural killer cell mediated cytotoxicity umr04664   Fc epsilon RI signaling pathway umr04666   Fc gamma R-mediated phagocytosis umr04670   Leukocyte transendothelial migration umr04713   Circadian entrainment umr04720   Long-term potentiation umr04723   Retrograde endocannabinoid signaling umr04724   Glutamatergic synapse umr04725   Cholinergic synapse umr04726   Serotonergic synapse umr04727   GABAergic synapse umr04728   Dopaminergic synapse umr04730   Long-term depression umr04750   Inflammatory mediator regulation of TRP channels umr04911   Insulin secretion umr04912   GnRH signaling pathway umr04916   Melanogenesis umr04918   Thyroid hormone synthesis umr04919   Thyroid hormone signaling pathway umr04921   Oxytocin signaling pathway umr04925   Aldosterone synthesis and secretion umr04926   Relaxin signaling pathway umr04928   Parathyroid hormone synthesis, secretion and action umr04929   GnRH secretion umr04933   AGE-RAGE signaling pathway in diabetic complications umr04935   Growth hormone synthesis, secretion and action umr04960   Aldosterone-regulated sodium reabsorption umr04961   Endocrine and other factor-regulated calcium reabsorption umr04970   Salivary secretion umr04971   Gastric acid secretion umr04972   Pancreatic secretion umr05017   Spinocerebellar ataxia umr05022   Pathways of neurodegeneration - multiple diseases umr05031   Amphetamine addiction umr05032   Morphine addiction umr05143   African trypanosomiasis umr05146   Amoebiasis umr05161   Hepatitis B umr05163   Human cytomegalovirus infection umr05164   Influenza A umr05170   Human immunodeficiency virus 1 infection umr05171   Coronavirus disease - COVID-19 umr05200   Pathways in cancer umr05205   Proteoglycans in cancer umr05206   MicroRNAs in cancer umr05214   Glioma umr05223   Non-small cell lung cancer umr05225   Hepatocellular carcinoma umr05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103665907 (PRKCA)    04012 ErbB signaling pathway     103665907 (PRKCA)    04014 Ras signaling pathway     103665907 (PRKCA)    04015 Rap1 signaling pathway     103665907 (PRKCA)    04310 Wnt signaling pathway     103665907 (PRKCA)    04370 VEGF signaling pathway     103665907 (PRKCA)    04066 HIF-1 signaling pathway     103665907 (PRKCA)    04020 Calcium signaling pathway     103665907 (PRKCA)    04070 Phosphatidylinositol signaling system     103665907 (PRKCA)    04072 Phospholipase D signaling pathway     103665907 (PRKCA)    04071 Sphingolipid signaling pathway     103665907 (PRKCA)    04151 PI3K-Akt signaling pathway     103665907 (PRKCA)    04150 mTOR signaling pathway     103665907 (PRKCA)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     103665907 (PRKCA)    04540 Gap junction     103665907 (PRKCA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103665907 (PRKCA)    04650 Natural killer cell mediated cytotoxicity     103665907 (PRKCA)    04664 Fc epsilon RI signaling pathway     103665907 (PRKCA)    04666 Fc gamma R-mediated phagocytosis     103665907 (PRKCA)    04670 Leukocyte transendothelial migration     103665907 (PRKCA)   09152 Endocrine system    04911 Insulin secretion     103665907 (PRKCA)    04929 GnRH secretion     103665907 (PRKCA)    04912 GnRH signaling pathway     103665907 (PRKCA)    04921 Oxytocin signaling pathway     103665907 (PRKCA)    04926 Relaxin signaling pathway     103665907 (PRKCA)    04935 Growth hormone synthesis, secretion and action     103665907 (PRKCA)    04918 Thyroid hormone synthesis     103665907 (PRKCA)    04919 Thyroid hormone signaling pathway     103665907 (PRKCA)    04928 Parathyroid hormone synthesis, secretion and action     103665907 (PRKCA)    04916 Melanogenesis     103665907 (PRKCA)    04925 Aldosterone synthesis and secretion     103665907 (PRKCA)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     103665907 (PRKCA)    04270 Vascular smooth muscle contraction     103665907 (PRKCA)   09154 Digestive system    04970 Salivary secretion     103665907 (PRKCA)    04971 Gastric acid secretion     103665907 (PRKCA)    04972 Pancreatic secretion     103665907 (PRKCA)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     103665907 (PRKCA)    04961 Endocrine and other factor-regulated calcium reabsorption     103665907 (PRKCA)   09156 Nervous system    04724 Glutamatergic synapse     103665907 (PRKCA)    04727 GABAergic synapse     103665907 (PRKCA)    04725 Cholinergic synapse     103665907 (PRKCA)    04728 Dopaminergic synapse     103665907 (PRKCA)    04726 Serotonergic synapse     103665907 (PRKCA)    04720 Long-term potentiation     103665907 (PRKCA)    04730 Long-term depression     103665907 (PRKCA)    04723 Retrograde endocannabinoid signaling     103665907 (PRKCA)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     103665907 (PRKCA)   09158 Development and regeneration    04360 Axon guidance     103665907 (PRKCA)   09159 Environmental adaptation    04713 Circadian entrainment     103665907 (PRKCA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103665907 (PRKCA)    05206 MicroRNAs in cancer     103665907 (PRKCA)    05205 Proteoglycans in cancer     103665907 (PRKCA)    05231 Choline metabolism in cancer     103665907 (PRKCA)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     103665907 (PRKCA)    05214 Glioma     103665907 (PRKCA)    05223 Non-small cell lung cancer     103665907 (PRKCA)   09164 Neurodegenerative disease    05017 Spinocerebellar ataxia     103665907 (PRKCA)    05022 Pathways of neurodegeneration - multiple diseases     103665907 (PRKCA)   09165 Substance dependence    05031 Amphetamine addiction     103665907 (PRKCA)    05032 Morphine addiction     103665907 (PRKCA)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103665907 (PRKCA)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103665907 (PRKCA)    05161 Hepatitis B     103665907 (PRKCA)    05171 Coronavirus disease - COVID-19     103665907 (PRKCA)    05164 Influenza A     103665907 (PRKCA)    05163 Human cytomegalovirus infection     103665907 (PRKCA)   09174 Infectious disease: parasitic    05146 Amoebiasis     103665907 (PRKCA)    05143 African trypanosomiasis     103665907 (PRKCA)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103665907 (PRKCA)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:umr01001]     103665907 (PRKCA)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:umr04131]     103665907 (PRKCA) Enzymes [BR:umr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.13  protein kinase C      103665907 (PRKCA) Protein kinases [BR:umr01001]  Serine/threonine kinases: AGC group   PKC family [OT]    103665907 (PRKCA) Membrane trafficking [BR:umr04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     103665907 (PRKCA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr C2 C1_1 Pkinase_C C1_2 APH Motif Other DBs NCBI-GeneID:  103665907 NCBI-ProteinID:  XP_008692162 UniProt:  A0A384CBF0 LinkDB All DBs Position Un AA seq 659 aa AA seqDB search MRLSPVISQPPSSEFFLYPQGTTVTTEARTQSHNRKEKRSIVFIWGFGKQGFQCQVCCFV VHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCD TCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSD PYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRN DFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNAELRQKFEKAKLGPA GNKVISPSEDRRQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKD VVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVG KFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGV TTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEH NVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPP FKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt atgcgtcttagcccagttatcagtcaaccaccttctagtgagttctttctatacccacaa ggaacaacggtaacaactgaggcaagaacgcaaagccacaaccggaaagaaaagagatct attgtcttcatctgggggtttgggaaacaaggcttccagtgccaagtttgctgttttgtg gttcacaagaggtgccatgaatttgtcactttttcttgtccgggtgcggataagggaccc gacactgacgacccaagaagcaagcacaagtttaaaatccacacttatggaagccccacc ttctgtgatcactgtgggtccttgctgtatggacttatccatcaagggatgaaatgtgac acctgcgacatgaacgtgcacaaacagtgcgtgatcaacgtgcccagcctctgcgggatg gaccacacggagaagaggggccgcatctacctgaaggcggaggtcaccgacgagaagctc cacgtcaccgtacgagatgcaaaaaatctaattcctatggatccaaatgggctttcagat ccttatgtgaagctgaaacttattcctgatcccaagaatgagagcaaacagaaaaccaaa accatccgctccacactgaacccccagtggaatgagtcctttacattcaaattaaaacct tcggataaagaccgacggctgtccgtagaaatctgggactgggatcgaacaactaggaat gatttcatggggtccctttcctttggagtctcggagctgatgaagatgccggccagcgga tggtacaagctgcttaaccaagaggaaggtgagtactacaatgtacccattccggaaggg gacgaagaaggcaacgcggagctcaggcagaaattcgagaaagccaagcttggcccagct ggtaacaaagtaatcagtccttcagaagacagaagacaaccttccaacaacctggacaga gtgaaactcaccgacttcaatttcctcatggtgctggggaaggggagttttggaaaggtg atgcttgctgaccggaagggcacagaggaactgtatgctatcaaaatcctgaagaaggat gtggtgattcaggatgacgacgtggagtgcaccatggtggagaagcgagtcctagccctc ctggacaagcccccgttcctgacacagctacactcctgcttccagacagtggatcggctg tacttcgtcatggaatacgtcaacggcggggacctcatgtaccacattcagcaagtagga aaatttaaggaaccacaagcagtattttatgcagcagagatttccattggattgttcttt cttcataaaagaggaatcatttacagggatctgaagttagataatgtcatgctggattcg gaagggcatatcaagattgccgattttgggatgtgcaaggaacacatgatggacggagtc acaaccaggaccttctgtgggacgccagattacatcgccccagagataatcgcatatcag ccgtatggaaaatccgtggactggtgggcctatggcgtcctgttgtatgaaatgctagcc gggcagcctccctttgatggcgaagatgaagacgagctgtttcagtccataatggagcat aacgtttcttatcccaagtccttgtccaaggaggccgtttccatctgcaagggactgatg accaaacacccaggcaagcggctgggttgcgggccggagggggagagggacgtgcgggaa catgccttcttccggaggatcgactgggagaaactcgagaacagggagatccaaccgccc ttcaagcccaaagtgtgtggcaaaggcgcagaaaactttgacaagttcttcacgcgaggg cagcctgtcttgacaccacctgatcagctggtcattgctaacatagaccagtctgatttc gaggggttctcgtatgtcaacccccagtttgtgcaccccatcttacagagcgcagtatga

Ursus maritimus (polar bear): 103668895 Help Entry 103668895         CDS       T03271                                  Gene name PRKCB Definition (RefSeq) protein kinase C beta   KO K19662   classical protein kinase C beta type [EC:2.7.11.13] Organism umr  Ursus maritimus (polar bear) Pathway umr01521   EGFR tyrosine kinase inhibitor resistance umr04010   MAPK signaling pathway umr04012   ErbB signaling pathway umr04014   Ras signaling pathway umr04015   Rap1 signaling pathway umr04020   Calcium signaling pathway umr04062   Chemokine signaling pathway umr04064   NF-kappa B signaling pathway umr04066   HIF-1 signaling pathway umr04070   Phosphatidylinositol signaling system umr04071   Sphingolipid signaling pathway umr04150   mTOR signaling pathway umr04270   Vascular smooth muscle contraction umr04310   Wnt signaling pathway umr04370   VEGF signaling pathway umr04510   Focal adhesion umr04540   Gap junction umr04613   Neutrophil extracellular trap formation umr04650   Natural killer cell mediated cytotoxicity umr04662   B cell receptor signaling pathway umr04666   Fc gamma R-mediated phagocytosis umr04670   Leukocyte transendothelial migration umr04713   Circadian entrainment umr04720   Long-term potentiation umr04723   Retrograde endocannabinoid signaling umr04724   Glutamatergic synapse umr04725   Cholinergic synapse umr04726   Serotonergic synapse umr04727   GABAergic synapse umr04728   Dopaminergic synapse umr04730   Long-term depression umr04750   Inflammatory mediator regulation of TRP channels umr04911   Insulin secretion umr04912   GnRH signaling pathway umr04916   Melanogenesis umr04918   Thyroid hormone synthesis umr04919   Thyroid hormone signaling pathway umr04921   Oxytocin signaling pathway umr04925   Aldosterone synthesis and secretion umr04928   Parathyroid hormone synthesis, secretion and action umr04929   GnRH secretion umr04931   Insulin resistance umr04933   AGE-RAGE signaling pathway in diabetic complications umr04935   Growth hormone synthesis, secretion and action umr04960   Aldosterone-regulated sodium reabsorption umr04961   Endocrine and other factor-regulated calcium reabsorption umr04970   Salivary secretion umr04971   Gastric acid secretion umr04972   Pancreatic secretion umr04973   Carbohydrate digestion and absorption umr05017   Spinocerebellar ataxia umr05022   Pathways of neurodegeneration - multiple diseases umr05031   Amphetamine addiction umr05032   Morphine addiction umr05140   Leishmaniasis umr05143   African trypanosomiasis umr05146   Amoebiasis umr05161   Hepatitis B umr05163   Human cytomegalovirus infection umr05164   Influenza A umr05170   Human immunodeficiency virus 1 infection umr05171   Coronavirus disease - COVID-19 umr05200   Pathways in cancer umr05205   Proteoglycans in cancer umr05206   MicroRNAs in cancer umr05214   Glioma umr05223   Non-small cell lung cancer umr05225   Hepatocellular carcinoma umr05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103668895 (PRKCB)    04012 ErbB signaling pathway     103668895 (PRKCB)    04014 Ras signaling pathway     103668895 (PRKCB)    04015 Rap1 signaling pathway     103668895 (PRKCB)    04310 Wnt signaling pathway     103668895 (PRKCB)    04370 VEGF signaling pathway     103668895 (PRKCB)    04064 NF-kappa B signaling pathway     103668895 (PRKCB)    04066 HIF-1 signaling pathway     103668895 (PRKCB)    04020 Calcium signaling pathway     103668895 (PRKCB)    04070 Phosphatidylinositol signaling system     103668895 (PRKCB)    04071 Sphingolipid signaling pathway     103668895 (PRKCB)    04150 mTOR signaling pathway     103668895 (PRKCB)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     103668895 (PRKCB)    04540 Gap junction     103668895 (PRKCB)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103668895 (PRKCB)    04650 Natural killer cell mediated cytotoxicity     103668895 (PRKCB)    04662 B cell receptor signaling pathway     103668895 (PRKCB)    04666 Fc gamma R-mediated phagocytosis     103668895 (PRKCB)    04670 Leukocyte transendothelial migration     103668895 (PRKCB)    04062 Chemokine signaling pathway     103668895 (PRKCB)   09152 Endocrine system    04911 Insulin secretion     103668895 (PRKCB)    04929 GnRH secretion     103668895 (PRKCB)    04912 GnRH signaling pathway     103668895 (PRKCB)    04921 Oxytocin signaling pathway     103668895 (PRKCB)    04935 Growth hormone synthesis, secretion and action     103668895 (PRKCB)    04918 Thyroid hormone synthesis     103668895 (PRKCB)    04919 Thyroid hormone signaling pathway     103668895 (PRKCB)    04928 Parathyroid hormone synthesis, secretion and action     103668895 (PRKCB)    04916 Melanogenesis     103668895 (PRKCB)    04925 Aldosterone synthesis and secretion     103668895 (PRKCB)   09153 Circulatory system    04270 Vascular smooth muscle contraction     103668895 (PRKCB)   09154 Digestive system    04970 Salivary secretion     103668895 (PRKCB)    04971 Gastric acid secretion     103668895 (PRKCB)    04972 Pancreatic secretion     103668895 (PRKCB)    04973 Carbohydrate digestion and absorption     103668895 (PRKCB)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     103668895 (PRKCB)    04961 Endocrine and other factor-regulated calcium reabsorption     103668895 (PRKCB)   09156 Nervous system    04724 Glutamatergic synapse     103668895 (PRKCB)    04727 GABAergic synapse     103668895 (PRKCB)    04725 Cholinergic synapse     103668895 (PRKCB)    04728 Dopaminergic synapse     103668895 (PRKCB)    04726 Serotonergic synapse     103668895 (PRKCB)    04720 Long-term potentiation     103668895 (PRKCB)    04730 Long-term depression     103668895 (PRKCB)    04723 Retrograde endocannabinoid signaling     103668895 (PRKCB)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     103668895 (PRKCB)   09159 Environmental adaptation    04713 Circadian entrainment     103668895 (PRKCB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103668895 (PRKCB)    05206 MicroRNAs in cancer     103668895 (PRKCB)    05205 Proteoglycans in cancer     103668895 (PRKCB)    05231 Choline metabolism in cancer     103668895 (PRKCB)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     103668895 (PRKCB)    05214 Glioma     103668895 (PRKCB)    05223 Non-small cell lung cancer     103668895 (PRKCB)   09164 Neurodegenerative disease    05017 Spinocerebellar ataxia     103668895 (PRKCB)    05022 Pathways of neurodegeneration - multiple diseases     103668895 (PRKCB)   09165 Substance dependence    05031 Amphetamine addiction     103668895 (PRKCB)    05032 Morphine addiction     103668895 (PRKCB)   09167 Endocrine and metabolic disease    04931 Insulin resistance     103668895 (PRKCB)    04933 AGE-RAGE signaling pathway in diabetic complications     103668895 (PRKCB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103668895 (PRKCB)    05161 Hepatitis B     103668895 (PRKCB)    05171 Coronavirus disease - COVID-19     103668895 (PRKCB)    05164 Influenza A     103668895 (PRKCB)    05163 Human cytomegalovirus infection     103668895 (PRKCB)   09174 Infectious disease: parasitic    05146 Amoebiasis     103668895 (PRKCB)    05140 Leishmaniasis     103668895 (PRKCB)    05143 African trypanosomiasis     103668895 (PRKCB)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103668895 (PRKCB)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:umr01001]     103668895 (PRKCB) Enzymes [BR:umr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.13  protein kinase C      103668895 (PRKCB) Protein kinases [BR:umr01001]  Serine/threonine kinases: AGC group   PKC family [OT]    103668895 (PRKCB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH Motif Other DBs NCBI-GeneID:  103668895 NCBI-ProteinID:  XP_008695432 UniProt:  A0A384CKT0 LinkDB All DBs Position Un AA seq 615 aa AA seqDB search MRLYLFSFPEGTRASLGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKH KFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRI YIQAHIEREVLIVVVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPE WNETFRFQLKESDKDRRLSVEIWDWDLXLSFGISELQKAGVDGWFKLLSQEEGEYFNVPV PPEGSEGNEELRQKFERAKISQGTKAPEEKTTNTISKLDNNGNRDRMKLTDFNFLMVLGK GSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPLYASALWDRL YFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDS EGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLA GQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKE HAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNE FAGFSYTNPEFVINV NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt atgcgtctttatctcttctctttccccgaaggtactcgggcatctctgggcttcggaaag caaggattccagtgccaagtctgctgttttgttgtgcacaagcggtgccatgaatttgtc accttctcctgcccaggcgccgacaaaggcccagcctccgatgacccccggagcaaacac aagtttaagatccacacgtactccagccccacgttttgtgaccactgtgggtcactgctg tatggactcatccaccaggggatgaagtgtgacacctgcatgatgaacgtgcacaagcgc tgcgtgatgaacgtccccagcctgtgcggcacagaccacacggagcgccgcggccgcatc tacatccaggcccacatcgagagggaagtcctcatcgtagtcgtaagagatgctaaaaac cttgtacctatggaccccaatggcttgtcagacccttacgtgaaactgaaactgattcct gaccccaagagcgagagcaagcagaagaccaaaaccatcaagtgctccctcaaccctgag tggaatgagacattcagattccaactgaaagaatcggacaaagacagaagactgtctgta gagatttgggattgggatctgnctttgtcgtttgggatttccgaactgcagaaagctggt gttgatggctggtttaagctgctgagccaggaggaaggcgagtacttcaatgtgcctgtg ccgccggaaggaagcgaaggcaatgaagagctgcggcagaaattcgagagggccaagatc agtcaggggaccaaggctccagaagaaaagacgaccaacaccatatccaaacttgacaac aacgggaacagagaccgaatgaaactgaccgattttaacttcctgatggtgctcgggaaa ggaagctttggcaaggtcatgctctctgagcgaaaaggcacggacgagctctatgctgtg aagatcctgaagaaggacgtcgtgatccaggatgacgatgtggagtgcacgatggtggag aagcgggtgctggccctgcctggaaagccgctttatgcatctgcgctttgggaccgcctg tactttgtgatggagtatgtgaacgggggcgacctcatgtaccacatccaacaagtcggc cggtttaaggagcctcacgctgtattttacgctgccgaaattgccatcggtctgttcttc ttacagagcaagggcatcatttaccgtgacctcaaacttgacaatgtgatgctggattca gagggccacatcaagattgctgattttggcatgtgcaaagaaaacatctgggatggggtg accaccaagacattctgtggcactccagactacatcgcccctgagatcattgcctaccag ccctatgggaagtctgtggattggtgggcctttggagtcctgctgtatgaaatgttggct gggcaggcaccctttgaaggggaggatgaggatgaactcttccagtccatcatggaacac aatgtggcttaccccaagtccatgtccaaggaagctgtggccatctgcaaagggctgatg accaaacacccgggcaaacgtctgggttgcggacccgaaggtgaacgtgacatcaaggag catgcgtttttccggtatattgattgggagaaacttgaacgcaaagagattcagcccccg tataagccaaaagccagagacaagcgagacacctccaacttcgacaaagagttcaccaga cagcctgtggaactcacgcctaccgataaactcttcatcatgaacttggaccaaaatgaa tttgctggcttctcctatactaacccagagtttgtcattaatgtgtag

Ursus maritimus (polar bear): 103672914 Help Entry 103672914         CDS       T03271                                  Gene name PRKCG Definition (RefSeq) protein kinase C gamma   KO K19663   classical protein kinase C gamma type [EC:2.7.11.13] Organism umr  Ursus maritimus (polar bear) Pathway umr01521   EGFR tyrosine kinase inhibitor resistance umr04010   MAPK signaling pathway umr04012   ErbB signaling pathway umr04014   Ras signaling pathway umr04015   Rap1 signaling pathway umr04020   Calcium signaling pathway umr04066   HIF-1 signaling pathway umr04070   Phosphatidylinositol signaling system umr04071   Sphingolipid signaling pathway umr04150   mTOR signaling pathway umr04270   Vascular smooth muscle contraction umr04310   Wnt signaling pathway umr04370   VEGF signaling pathway umr04510   Focal adhesion umr04540   Gap junction umr04613   Neutrophil extracellular trap formation umr04650   Natural killer cell mediated cytotoxicity umr04666   Fc gamma R-mediated phagocytosis umr04670   Leukocyte transendothelial migration umr04713   Circadian entrainment umr04720   Long-term potentiation umr04723   Retrograde endocannabinoid signaling umr04724   Glutamatergic synapse umr04725   Cholinergic synapse umr04726   Serotonergic synapse umr04727   GABAergic synapse umr04728   Dopaminergic synapse umr04730   Long-term depression umr04750   Inflammatory mediator regulation of TRP channels umr04911   Insulin secretion umr04916   Melanogenesis umr04918   Thyroid hormone synthesis umr04919   Thyroid hormone signaling pathway umr04921   Oxytocin signaling pathway umr04925   Aldosterone synthesis and secretion umr04928   Parathyroid hormone synthesis, secretion and action umr04929   GnRH secretion umr04935   Growth hormone synthesis, secretion and action umr04960   Aldosterone-regulated sodium reabsorption umr04961   Endocrine and other factor-regulated calcium reabsorption umr04970   Salivary secretion umr04971   Gastric acid secretion umr04972   Pancreatic secretion umr05017   Spinocerebellar ataxia umr05022   Pathways of neurodegeneration - multiple diseases umr05031   Amphetamine addiction umr05032   Morphine addiction umr05143   African trypanosomiasis umr05146   Amoebiasis umr05161   Hepatitis B umr05163   Human cytomegalovirus infection umr05170   Human immunodeficiency virus 1 infection umr05171   Coronavirus disease - COVID-19 umr05200   Pathways in cancer umr05205   Proteoglycans in cancer umr05206   MicroRNAs in cancer umr05214   Glioma umr05223   Non-small cell lung cancer umr05225   Hepatocellular carcinoma umr05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103672914 (PRKCG)    04012 ErbB signaling pathway     103672914 (PRKCG)    04014 Ras signaling pathway     103672914 (PRKCG)    04015 Rap1 signaling pathway     103672914 (PRKCG)    04310 Wnt signaling pathway     103672914 (PRKCG)    04370 VEGF signaling pathway     103672914 (PRKCG)    04066 HIF-1 signaling pathway     103672914 (PRKCG)    04020 Calcium signaling pathway     103672914 (PRKCG)    04070 Phosphatidylinositol signaling system     103672914 (PRKCG)    04071 Sphingolipid signaling pathway     103672914 (PRKCG)    04150 mTOR signaling pathway     103672914 (PRKCG)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     103672914 (PRKCG)    04540 Gap junction     103672914 (PRKCG)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103672914 (PRKCG)    04650 Natural killer cell mediated cytotoxicity     103672914 (PRKCG)    04666 Fc gamma R-mediated phagocytosis     103672914 (PRKCG)    04670 Leukocyte transendothelial migration     103672914 (PRKCG)   09152 Endocrine system    04911 Insulin secretion     103672914 (PRKCG)    04929 GnRH secretion     103672914 (PRKCG)    04921 Oxytocin signaling pathway     103672914 (PRKCG)    04935 Growth hormone synthesis, secretion and action     103672914 (PRKCG)    04918 Thyroid hormone synthesis     103672914 (PRKCG)    04919 Thyroid hormone signaling pathway     103672914 (PRKCG)    04928 Parathyroid hormone synthesis, secretion and action     103672914 (PRKCG)    04916 Melanogenesis     103672914 (PRKCG)    04925 Aldosterone synthesis and secretion     103672914 (PRKCG)   09153 Circulatory system    04270 Vascular smooth muscle contraction     103672914 (PRKCG)   09154 Digestive system    04970 Salivary secretion     103672914 (PRKCG)    04971 Gastric acid secretion     103672914 (PRKCG)    04972 Pancreatic secretion     103672914 (PRKCG)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     103672914 (PRKCG)    04961 Endocrine and other factor-regulated calcium reabsorption     103672914 (PRKCG)   09156 Nervous system    04724 Glutamatergic synapse     103672914 (PRKCG)    04727 GABAergic synapse     103672914 (PRKCG)    04725 Cholinergic synapse     103672914 (PRKCG)    04728 Dopaminergic synapse     103672914 (PRKCG)    04726 Serotonergic synapse     103672914 (PRKCG)    04720 Long-term potentiation     103672914 (PRKCG)    04730 Long-term depression     103672914 (PRKCG)    04723 Retrograde endocannabinoid signaling     103672914 (PRKCG)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     103672914 (PRKCG)   09159 Environmental adaptation    04713 Circadian entrainment     103672914 (PRKCG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103672914 (PRKCG)    05206 MicroRNAs in cancer     103672914 (PRKCG)    05205 Proteoglycans in cancer     103672914 (PRKCG)    05231 Choline metabolism in cancer     103672914 (PRKCG)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     103672914 (PRKCG)    05214 Glioma     103672914 (PRKCG)    05223 Non-small cell lung cancer     103672914 (PRKCG)   09164 Neurodegenerative disease    05017 Spinocerebellar ataxia     103672914 (PRKCG)    05022 Pathways of neurodegeneration - multiple diseases     103672914 (PRKCG)   09165 Substance dependence    05031 Amphetamine addiction     103672914 (PRKCG)    05032 Morphine addiction     103672914 (PRKCG)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103672914 (PRKCG)    05161 Hepatitis B     103672914 (PRKCG)    05171 Coronavirus disease - COVID-19     103672914 (PRKCG)    05163 Human cytomegalovirus infection     103672914 (PRKCG)   09174 Infectious disease: parasitic    05146 Amoebiasis     103672914 (PRKCG)    05143 African trypanosomiasis     103672914 (PRKCG)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103672914 (PRKCG)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:umr01001]     103672914 (PRKCG) Enzymes [BR:umr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.13  protein kinase C      103672914 (PRKCG) Protein kinases [BR:umr01001]  Serine/threonine kinases: AGC group   PKC family [OT]    103672914 (PRKCG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like APH Motif Other DBs NCBI-GeneID:  103672914 NCBI-ProteinID:  XP_008699839 UniProt:  A0A384CZC5 LinkDB All DBs Position Un AA seq 673 aa AA seqDB search MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEA RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWDSCPRACNYPLELYERVRMGPSSSPI PSPSPSPTDSKRCFFGTSPGRLHISDFSFLMVLGKGSFGKVMLAERRGSDELYAIKILKK DVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMY HIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKE NVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELF QAIMEQTVTYPKSLSREAVAICKGFLTKHPAKRLGSGPDGEPAIRAHGFFRWMDWERLER LEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPD ARSPISPPPVPVM NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt atggcaggcctgggccccggcggaggcgattcagaggggggaccccggcccctgttttgc agaaagggggctctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgcc cgcttcttcaagcagccaaccttctgcagccactgcaccgacttcatctggggaattgga aaacagggcctgcaatgtcaagtctgcagctttgtggttcatcgacgatgccacgaattt gtgaccttcgagtgtccaggcgctgggaagggcccccagacggatgacccccggaacaag cacaagttccgtctgcacagctacagcagccccaccttttgcgaccactgcggctccctc ctctacgggctggtgcaccagggcatgaaatgctcctgctgcgagatgaacgtgcaccga cgctgtgtgcgcagcgtgccctctctgtgcggggtggaccacaccgagcgccgtgggcgc ctgcagctggaaatccgggcaccgacggcagatgagatacacgtcacagttggcgaggcc cgtaacctcatcccgatggatcccaatggtctgtctgatccctatgtgaagctgaagctc atcccagaccctcggaacttgacgaaacagaagacccgaacagtgaaagccacactaaac cctgtgtggaacgagacctttgtgttcaacctgaagccgggggacgtggagcgccggctc agcgtggaggtgtgggactgggaccggacttcccgcaatgatttcatgggtgccatgtcc ttcggtgtctcggagctgctcaaggcgccagtggatggctgggactcctgccccagggcc tgtaactaccccctggaactgtatgagcgggtgcggatgggtccctcttcctctcccatc ccttccccatctcccagtcccaccgactccaagcgctgtttctttgggacgagccctgga cgtctgcacatctctgacttcagcttcctcatggttctaggaaaaggcagttttgggaag gtgatgctggctgagcgcaggggctccgatgagctctacgccatcaagatcctgaagaaa gacgtgattgttcaggatgacgacgtggactgcaccctggtggagaagcgagtgctggcc ctggggggccgaggcccgggcggccggccccactttctcacccagctgcattcgaccttc cagaccccggatcgcctgtattttgtgatggagtatgtcacggggggcgacctgatgtac cacatccagcagctgggcaagtttaaggagccccatgcagcgttctacgcagcggaaatc gccatcggcctcttcttccttcacaatcagggcatcatatatcgggacctgaaactagac aacgtgatgctggacgccgaaggacacatcaaaatcacggacttcggcatgtgtaaggag aacgtcttccccgggaccacgacccgcactttctgcgggaccccagactacatagcccct gagatcattgcctaccagccctatgggaagtctgtggattggtggtcctttggggttctg ctgtatgagatgctggcaggacagcccccttttgacggggaggatgaggaagagctcttt caggccatcatggaacaaactgtcacttaccccaagtcactttcccgggaagccgtggcg atctgcaaggggttcctaactaagcacccagcgaagcgcctgggctcagggccagacggg gagcccgccatccgtgctcatggctttttccgctggatggactgggagcgcctggaacga ctggagatcgcgcctccgttcagaccccgtccgtgtggacgcagcggtgagaacttcgac aaattcttcacgcgggcggcgccagcgctgaccccgccagaccgcctagtgttggccagc atcgaccaggccgatttccaaggcttcacctacgtgaacccggatttcgtgcacccggac gcccgcagccccatcagcccaccgcctgtgccagtcatgtaa

DBGET integrated database retrieval system