KEGG   Ursus maritimus (polar bear): 103665907
Entry
103665907         CDS       T03271                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04066  HIF-1 signaling pathway
umr04070  Phosphatidylinositol signaling system
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04310  Wnt signaling pathway
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04510  Focal adhesion
umr04540  Gap junction
umr04613  Neutrophil extracellular trap formation
umr04650  Natural killer cell mediated cytotoxicity
umr04664  Fc epsilon RI signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04670  Leukocyte transendothelial migration
umr04713  Circadian entrainment
umr04720  Long-term potentiation
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04727  GABAergic synapse
umr04728  Dopaminergic synapse
umr04730  Long-term depression
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04919  Thyroid hormone signaling pathway
umr04921  Oxytocin signaling pathway
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr04929  GnRH secretion
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr04960  Aldosterone-regulated sodium reabsorption
umr04961  Endocrine and other factor-regulated calcium reabsorption
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr05017  Spinocerebellar ataxia
umr05022  Pathways of neurodegeneration - multiple diseases
umr05031  Amphetamine addiction
umr05032  Morphine addiction
umr05143  African trypanosomiasis
umr05146  Amoebiasis
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05214  Glioma
umr05223  Non-small cell lung cancer
umr05225  Hepatocellular carcinoma
umr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103665907 (PRKCA)
   04012 ErbB signaling pathway
    103665907 (PRKCA)
   04014 Ras signaling pathway
    103665907 (PRKCA)
   04015 Rap1 signaling pathway
    103665907 (PRKCA)
   04310 Wnt signaling pathway
    103665907 (PRKCA)
   04370 VEGF signaling pathway
    103665907 (PRKCA)
   04066 HIF-1 signaling pathway
    103665907 (PRKCA)
   04020 Calcium signaling pathway
    103665907 (PRKCA)
   04070 Phosphatidylinositol signaling system
    103665907 (PRKCA)
   04072 Phospholipase D signaling pathway
    103665907 (PRKCA)
   04071 Sphingolipid signaling pathway
    103665907 (PRKCA)
   04151 PI3K-Akt signaling pathway
    103665907 (PRKCA)
   04150 mTOR signaling pathway
    103665907 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103665907 (PRKCA)
   04540 Gap junction
    103665907 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103665907 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    103665907 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    103665907 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    103665907 (PRKCA)
   04670 Leukocyte transendothelial migration
    103665907 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    103665907 (PRKCA)
   04929 GnRH secretion
    103665907 (PRKCA)
   04912 GnRH signaling pathway
    103665907 (PRKCA)
   04921 Oxytocin signaling pathway
    103665907 (PRKCA)
   04926 Relaxin signaling pathway
    103665907 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    103665907 (PRKCA)
   04918 Thyroid hormone synthesis
    103665907 (PRKCA)
   04919 Thyroid hormone signaling pathway
    103665907 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    103665907 (PRKCA)
   04916 Melanogenesis
    103665907 (PRKCA)
   04925 Aldosterone synthesis and secretion
    103665907 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103665907 (PRKCA)
   04270 Vascular smooth muscle contraction
    103665907 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    103665907 (PRKCA)
   04971 Gastric acid secretion
    103665907 (PRKCA)
   04972 Pancreatic secretion
    103665907 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103665907 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103665907 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    103665907 (PRKCA)
   04727 GABAergic synapse
    103665907 (PRKCA)
   04725 Cholinergic synapse
    103665907 (PRKCA)
   04728 Dopaminergic synapse
    103665907 (PRKCA)
   04726 Serotonergic synapse
    103665907 (PRKCA)
   04720 Long-term potentiation
    103665907 (PRKCA)
   04730 Long-term depression
    103665907 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    103665907 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103665907 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    103665907 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103665907 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103665907 (PRKCA)
   05206 MicroRNAs in cancer
    103665907 (PRKCA)
   05205 Proteoglycans in cancer
    103665907 (PRKCA)
   05231 Choline metabolism in cancer
    103665907 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103665907 (PRKCA)
   05214 Glioma
    103665907 (PRKCA)
   05223 Non-small cell lung cancer
    103665907 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    103665907 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    103665907 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    103665907 (PRKCA)
   05032 Morphine addiction
    103665907 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103665907 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103665907 (PRKCA)
   05161 Hepatitis B
    103665907 (PRKCA)
   05171 Coronavirus disease - COVID-19
    103665907 (PRKCA)
   05164 Influenza A
    103665907 (PRKCA)
   05163 Human cytomegalovirus infection
    103665907 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103665907 (PRKCA)
   05143 African trypanosomiasis
    103665907 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103665907 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103665907 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103665907 (PRKCA)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     103665907 (PRKCA)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   103665907 (PRKCA)
Membrane trafficking [BR:umr04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    103665907 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C2 C1_1 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 103665907
NCBI-ProteinID: XP_008692162
UniProt: A0A384CBF0
LinkDB
Position
Un
AA seq 659 aa
MRLSPVISQPPSSEFFLYPQGTTVTTEARTQSHNRKEKRSIVFIWGFGKQGFQCQVCCFV
VHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCD
TCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSD
PYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRN
DFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNAELRQKFEKAKLGPA
GNKVISPSEDRRQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKD
VVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVG
KFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGV
TTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEH
NVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPP
FKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
NT seq 1980 nt   +upstreamnt  +downstreamnt
atgcgtcttagcccagttatcagtcaaccaccttctagtgagttctttctatacccacaa
ggaacaacggtaacaactgaggcaagaacgcaaagccacaaccggaaagaaaagagatct
attgtcttcatctgggggtttgggaaacaaggcttccagtgccaagtttgctgttttgtg
gttcacaagaggtgccatgaatttgtcactttttcttgtccgggtgcggataagggaccc
gacactgacgacccaagaagcaagcacaagtttaaaatccacacttatggaagccccacc
ttctgtgatcactgtgggtccttgctgtatggacttatccatcaagggatgaaatgtgac
acctgcgacatgaacgtgcacaaacagtgcgtgatcaacgtgcccagcctctgcgggatg
gaccacacggagaagaggggccgcatctacctgaaggcggaggtcaccgacgagaagctc
cacgtcaccgtacgagatgcaaaaaatctaattcctatggatccaaatgggctttcagat
ccttatgtgaagctgaaacttattcctgatcccaagaatgagagcaaacagaaaaccaaa
accatccgctccacactgaacccccagtggaatgagtcctttacattcaaattaaaacct
tcggataaagaccgacggctgtccgtagaaatctgggactgggatcgaacaactaggaat
gatttcatggggtccctttcctttggagtctcggagctgatgaagatgccggccagcgga
tggtacaagctgcttaaccaagaggaaggtgagtactacaatgtacccattccggaaggg
gacgaagaaggcaacgcggagctcaggcagaaattcgagaaagccaagcttggcccagct
ggtaacaaagtaatcagtccttcagaagacagaagacaaccttccaacaacctggacaga
gtgaaactcaccgacttcaatttcctcatggtgctggggaaggggagttttggaaaggtg
atgcttgctgaccggaagggcacagaggaactgtatgctatcaaaatcctgaagaaggat
gtggtgattcaggatgacgacgtggagtgcaccatggtggagaagcgagtcctagccctc
ctggacaagcccccgttcctgacacagctacactcctgcttccagacagtggatcggctg
tacttcgtcatggaatacgtcaacggcggggacctcatgtaccacattcagcaagtagga
aaatttaaggaaccacaagcagtattttatgcagcagagatttccattggattgttcttt
cttcataaaagaggaatcatttacagggatctgaagttagataatgtcatgctggattcg
gaagggcatatcaagattgccgattttgggatgtgcaaggaacacatgatggacggagtc
acaaccaggaccttctgtgggacgccagattacatcgccccagagataatcgcatatcag
ccgtatggaaaatccgtggactggtgggcctatggcgtcctgttgtatgaaatgctagcc
gggcagcctccctttgatggcgaagatgaagacgagctgtttcagtccataatggagcat
aacgtttcttatcccaagtccttgtccaaggaggccgtttccatctgcaagggactgatg
accaaacacccaggcaagcggctgggttgcgggccggagggggagagggacgtgcgggaa
catgccttcttccggaggatcgactgggagaaactcgagaacagggagatccaaccgccc
ttcaagcccaaagtgtgtggcaaaggcgcagaaaactttgacaagttcttcacgcgaggg
cagcctgtcttgacaccacctgatcagctggtcattgctaacatagaccagtctgatttc
gaggggttctcgtatgtcaacccccagtttgtgcaccccatcttacagagcgcagtatga

KEGG   Ursus maritimus (polar bear): 103668895
Entry
103668895         CDS       T03271                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04062  Chemokine signaling pathway
umr04064  NF-kappa B signaling pathway
umr04066  HIF-1 signaling pathway
umr04070  Phosphatidylinositol signaling system
umr04071  Sphingolipid signaling pathway
umr04150  mTOR signaling pathway
umr04270  Vascular smooth muscle contraction
umr04310  Wnt signaling pathway
umr04370  VEGF signaling pathway
umr04510  Focal adhesion
umr04540  Gap junction
umr04613  Neutrophil extracellular trap formation
umr04650  Natural killer cell mediated cytotoxicity
umr04662  B cell receptor signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04670  Leukocyte transendothelial migration
umr04713  Circadian entrainment
umr04720  Long-term potentiation
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04727  GABAergic synapse
umr04728  Dopaminergic synapse
umr04730  Long-term depression
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04919  Thyroid hormone signaling pathway
umr04921  Oxytocin signaling pathway
umr04925  Aldosterone synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04929  GnRH secretion
umr04931  Insulin resistance
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr04960  Aldosterone-regulated sodium reabsorption
umr04961  Endocrine and other factor-regulated calcium reabsorption
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr04973  Carbohydrate digestion and absorption
umr05017  Spinocerebellar ataxia
umr05022  Pathways of neurodegeneration - multiple diseases
umr05031  Amphetamine addiction
umr05032  Morphine addiction
umr05140  Leishmaniasis
umr05143  African trypanosomiasis
umr05146  Amoebiasis
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05214  Glioma
umr05223  Non-small cell lung cancer
umr05225  Hepatocellular carcinoma
umr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103668895 (PRKCB)
   04012 ErbB signaling pathway
    103668895 (PRKCB)
   04014 Ras signaling pathway
    103668895 (PRKCB)
   04015 Rap1 signaling pathway
    103668895 (PRKCB)
   04310 Wnt signaling pathway
    103668895 (PRKCB)
   04370 VEGF signaling pathway
    103668895 (PRKCB)
   04064 NF-kappa B signaling pathway
    103668895 (PRKCB)
   04066 HIF-1 signaling pathway
    103668895 (PRKCB)
   04020 Calcium signaling pathway
    103668895 (PRKCB)
   04070 Phosphatidylinositol signaling system
    103668895 (PRKCB)
   04071 Sphingolipid signaling pathway
    103668895 (PRKCB)
   04150 mTOR signaling pathway
    103668895 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103668895 (PRKCB)
   04540 Gap junction
    103668895 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103668895 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    103668895 (PRKCB)
   04662 B cell receptor signaling pathway
    103668895 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    103668895 (PRKCB)
   04670 Leukocyte transendothelial migration
    103668895 (PRKCB)
   04062 Chemokine signaling pathway
    103668895 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    103668895 (PRKCB)
   04929 GnRH secretion
    103668895 (PRKCB)
   04912 GnRH signaling pathway
    103668895 (PRKCB)
   04921 Oxytocin signaling pathway
    103668895 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    103668895 (PRKCB)
   04918 Thyroid hormone synthesis
    103668895 (PRKCB)
   04919 Thyroid hormone signaling pathway
    103668895 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    103668895 (PRKCB)
   04916 Melanogenesis
    103668895 (PRKCB)
   04925 Aldosterone synthesis and secretion
    103668895 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103668895 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    103668895 (PRKCB)
   04971 Gastric acid secretion
    103668895 (PRKCB)
   04972 Pancreatic secretion
    103668895 (PRKCB)
   04973 Carbohydrate digestion and absorption
    103668895 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103668895 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103668895 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    103668895 (PRKCB)
   04727 GABAergic synapse
    103668895 (PRKCB)
   04725 Cholinergic synapse
    103668895 (PRKCB)
   04728 Dopaminergic synapse
    103668895 (PRKCB)
   04726 Serotonergic synapse
    103668895 (PRKCB)
   04720 Long-term potentiation
    103668895 (PRKCB)
   04730 Long-term depression
    103668895 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    103668895 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103668895 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103668895 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103668895 (PRKCB)
   05206 MicroRNAs in cancer
    103668895 (PRKCB)
   05205 Proteoglycans in cancer
    103668895 (PRKCB)
   05231 Choline metabolism in cancer
    103668895 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103668895 (PRKCB)
   05214 Glioma
    103668895 (PRKCB)
   05223 Non-small cell lung cancer
    103668895 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    103668895 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    103668895 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    103668895 (PRKCB)
   05032 Morphine addiction
    103668895 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103668895 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103668895 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103668895 (PRKCB)
   05161 Hepatitis B
    103668895 (PRKCB)
   05171 Coronavirus disease - COVID-19
    103668895 (PRKCB)
   05164 Influenza A
    103668895 (PRKCB)
   05163 Human cytomegalovirus infection
    103668895 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103668895 (PRKCB)
   05140 Leishmaniasis
    103668895 (PRKCB)
   05143 African trypanosomiasis
    103668895 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103668895 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103668895 (PRKCB)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     103668895 (PRKCB)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   103668895 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 103668895
NCBI-ProteinID: XP_008695432
UniProt: A0A384CKT0
LinkDB
Position
Un
AA seq 615 aa
MRLYLFSFPEGTRASLGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKH
KFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRI
YIQAHIEREVLIVVVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPE
WNETFRFQLKESDKDRRLSVEIWDWDLXLSFGISELQKAGVDGWFKLLSQEEGEYFNVPV
PPEGSEGNEELRQKFERAKISQGTKAPEEKTTNTISKLDNNGNRDRMKLTDFNFLMVLGK
GSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPLYASALWDRL
YFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDS
EGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLA
GQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKE
HAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNE
FAGFSYTNPEFVINV
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgcgtctttatctcttctctttccccgaaggtactcgggcatctctgggcttcggaaag
caaggattccagtgccaagtctgctgttttgttgtgcacaagcggtgccatgaatttgtc
accttctcctgcccaggcgccgacaaaggcccagcctccgatgacccccggagcaaacac
aagtttaagatccacacgtactccagccccacgttttgtgaccactgtgggtcactgctg
tatggactcatccaccaggggatgaagtgtgacacctgcatgatgaacgtgcacaagcgc
tgcgtgatgaacgtccccagcctgtgcggcacagaccacacggagcgccgcggccgcatc
tacatccaggcccacatcgagagggaagtcctcatcgtagtcgtaagagatgctaaaaac
cttgtacctatggaccccaatggcttgtcagacccttacgtgaaactgaaactgattcct
gaccccaagagcgagagcaagcagaagaccaaaaccatcaagtgctccctcaaccctgag
tggaatgagacattcagattccaactgaaagaatcggacaaagacagaagactgtctgta
gagatttgggattgggatctgnctttgtcgtttgggatttccgaactgcagaaagctggt
gttgatggctggtttaagctgctgagccaggaggaaggcgagtacttcaatgtgcctgtg
ccgccggaaggaagcgaaggcaatgaagagctgcggcagaaattcgagagggccaagatc
agtcaggggaccaaggctccagaagaaaagacgaccaacaccatatccaaacttgacaac
aacgggaacagagaccgaatgaaactgaccgattttaacttcctgatggtgctcgggaaa
ggaagctttggcaaggtcatgctctctgagcgaaaaggcacggacgagctctatgctgtg
aagatcctgaagaaggacgtcgtgatccaggatgacgatgtggagtgcacgatggtggag
aagcgggtgctggccctgcctggaaagccgctttatgcatctgcgctttgggaccgcctg
tactttgtgatggagtatgtgaacgggggcgacctcatgtaccacatccaacaagtcggc
cggtttaaggagcctcacgctgtattttacgctgccgaaattgccatcggtctgttcttc
ttacagagcaagggcatcatttaccgtgacctcaaacttgacaatgtgatgctggattca
gagggccacatcaagattgctgattttggcatgtgcaaagaaaacatctgggatggggtg
accaccaagacattctgtggcactccagactacatcgcccctgagatcattgcctaccag
ccctatgggaagtctgtggattggtgggcctttggagtcctgctgtatgaaatgttggct
gggcaggcaccctttgaaggggaggatgaggatgaactcttccagtccatcatggaacac
aatgtggcttaccccaagtccatgtccaaggaagctgtggccatctgcaaagggctgatg
accaaacacccgggcaaacgtctgggttgcggacccgaaggtgaacgtgacatcaaggag
catgcgtttttccggtatattgattgggagaaacttgaacgcaaagagattcagcccccg
tataagccaaaagccagagacaagcgagacacctccaacttcgacaaagagttcaccaga
cagcctgtggaactcacgcctaccgataaactcttcatcatgaacttggaccaaaatgaa
tttgctggcttctcctatactaacccagagtttgtcattaatgtgtag

KEGG   Ursus maritimus (polar bear): 103672914
Entry
103672914         CDS       T03271                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04066  HIF-1 signaling pathway
umr04070  Phosphatidylinositol signaling system
umr04071  Sphingolipid signaling pathway
umr04150  mTOR signaling pathway
umr04270  Vascular smooth muscle contraction
umr04310  Wnt signaling pathway
umr04370  VEGF signaling pathway
umr04510  Focal adhesion
umr04540  Gap junction
umr04613  Neutrophil extracellular trap formation
umr04650  Natural killer cell mediated cytotoxicity
umr04666  Fc gamma R-mediated phagocytosis
umr04670  Leukocyte transendothelial migration
umr04713  Circadian entrainment
umr04720  Long-term potentiation
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04727  GABAergic synapse
umr04728  Dopaminergic synapse
umr04730  Long-term depression
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04919  Thyroid hormone signaling pathway
umr04921  Oxytocin signaling pathway
umr04925  Aldosterone synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04929  GnRH secretion
umr04935  Growth hormone synthesis, secretion and action
umr04960  Aldosterone-regulated sodium reabsorption
umr04961  Endocrine and other factor-regulated calcium reabsorption
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr05017  Spinocerebellar ataxia
umr05022  Pathways of neurodegeneration - multiple diseases
umr05031  Amphetamine addiction
umr05032  Morphine addiction
umr05143  African trypanosomiasis
umr05146  Amoebiasis
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05214  Glioma
umr05223  Non-small cell lung cancer
umr05225  Hepatocellular carcinoma
umr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103672914 (PRKCG)
   04012 ErbB signaling pathway
    103672914 (PRKCG)
   04014 Ras signaling pathway
    103672914 (PRKCG)
   04015 Rap1 signaling pathway
    103672914 (PRKCG)
   04310 Wnt signaling pathway
    103672914 (PRKCG)
   04370 VEGF signaling pathway
    103672914 (PRKCG)
   04066 HIF-1 signaling pathway
    103672914 (PRKCG)
   04020 Calcium signaling pathway
    103672914 (PRKCG)
   04070 Phosphatidylinositol signaling system
    103672914 (PRKCG)
   04071 Sphingolipid signaling pathway
    103672914 (PRKCG)
   04150 mTOR signaling pathway
    103672914 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103672914 (PRKCG)
   04540 Gap junction
    103672914 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103672914 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    103672914 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    103672914 (PRKCG)
   04670 Leukocyte transendothelial migration
    103672914 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    103672914 (PRKCG)
   04929 GnRH secretion
    103672914 (PRKCG)
   04921 Oxytocin signaling pathway
    103672914 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    103672914 (PRKCG)
   04918 Thyroid hormone synthesis
    103672914 (PRKCG)
   04919 Thyroid hormone signaling pathway
    103672914 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    103672914 (PRKCG)
   04916 Melanogenesis
    103672914 (PRKCG)
   04925 Aldosterone synthesis and secretion
    103672914 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103672914 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    103672914 (PRKCG)
   04971 Gastric acid secretion
    103672914 (PRKCG)
   04972 Pancreatic secretion
    103672914 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103672914 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103672914 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    103672914 (PRKCG)
   04727 GABAergic synapse
    103672914 (PRKCG)
   04725 Cholinergic synapse
    103672914 (PRKCG)
   04728 Dopaminergic synapse
    103672914 (PRKCG)
   04726 Serotonergic synapse
    103672914 (PRKCG)
   04720 Long-term potentiation
    103672914 (PRKCG)
   04730 Long-term depression
    103672914 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    103672914 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103672914 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103672914 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103672914 (PRKCG)
   05206 MicroRNAs in cancer
    103672914 (PRKCG)
   05205 Proteoglycans in cancer
    103672914 (PRKCG)
   05231 Choline metabolism in cancer
    103672914 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103672914 (PRKCG)
   05214 Glioma
    103672914 (PRKCG)
   05223 Non-small cell lung cancer
    103672914 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    103672914 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    103672914 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    103672914 (PRKCG)
   05032 Morphine addiction
    103672914 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103672914 (PRKCG)
   05161 Hepatitis B
    103672914 (PRKCG)
   05171 Coronavirus disease - COVID-19
    103672914 (PRKCG)
   05163 Human cytomegalovirus infection
    103672914 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103672914 (PRKCG)
   05143 African trypanosomiasis
    103672914 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103672914 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103672914 (PRKCG)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     103672914 (PRKCG)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   103672914 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like APH
Other DBs
NCBI-GeneID: 103672914
NCBI-ProteinID: XP_008699839
UniProt: A0A384CZC5
LinkDB
Position
Un
AA seq 673 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWDSCPRACNYPLELYERVRMGPSSSPI
PSPSPSPTDSKRCFFGTSPGRLHISDFSFLMVLGKGSFGKVMLAERRGSDELYAIKILKK
DVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMY
HIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKE
NVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELF
QAIMEQTVTYPKSLSREAVAICKGFLTKHPAKRLGSGPDGEPAIRAHGFFRWMDWERLER
LEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPD
ARSPISPPPVPVM
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggcaggcctgggccccggcggaggcgattcagaggggggaccccggcccctgttttgc
agaaagggggctctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgcc
cgcttcttcaagcagccaaccttctgcagccactgcaccgacttcatctggggaattgga
aaacagggcctgcaatgtcaagtctgcagctttgtggttcatcgacgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggatgacccccggaacaag
cacaagttccgtctgcacagctacagcagccccaccttttgcgaccactgcggctccctc
ctctacgggctggtgcaccagggcatgaaatgctcctgctgcgagatgaacgtgcaccga
cgctgtgtgcgcagcgtgccctctctgtgcggggtggaccacaccgagcgccgtgggcgc
ctgcagctggaaatccgggcaccgacggcagatgagatacacgtcacagttggcgaggcc
cgtaacctcatcccgatggatcccaatggtctgtctgatccctatgtgaagctgaagctc
atcccagaccctcggaacttgacgaaacagaagacccgaacagtgaaagccacactaaac
cctgtgtggaacgagacctttgtgttcaacctgaagccgggggacgtggagcgccggctc
agcgtggaggtgtgggactgggaccggacttcccgcaatgatttcatgggtgccatgtcc
ttcggtgtctcggagctgctcaaggcgccagtggatggctgggactcctgccccagggcc
tgtaactaccccctggaactgtatgagcgggtgcggatgggtccctcttcctctcccatc
ccttccccatctcccagtcccaccgactccaagcgctgtttctttgggacgagccctgga
cgtctgcacatctctgacttcagcttcctcatggttctaggaaaaggcagttttgggaag
gtgatgctggctgagcgcaggggctccgatgagctctacgccatcaagatcctgaagaaa
gacgtgattgttcaggatgacgacgtggactgcaccctggtggagaagcgagtgctggcc
ctggggggccgaggcccgggcggccggccccactttctcacccagctgcattcgaccttc
cagaccccggatcgcctgtattttgtgatggagtatgtcacggggggcgacctgatgtac
cacatccagcagctgggcaagtttaaggagccccatgcagcgttctacgcagcggaaatc
gccatcggcctcttcttccttcacaatcagggcatcatatatcgggacctgaaactagac
aacgtgatgctggacgccgaaggacacatcaaaatcacggacttcggcatgtgtaaggag
aacgtcttccccgggaccacgacccgcactttctgcgggaccccagactacatagcccct
gagatcattgcctaccagccctatgggaagtctgtggattggtggtcctttggggttctg
ctgtatgagatgctggcaggacagcccccttttgacggggaggatgaggaagagctcttt
caggccatcatggaacaaactgtcacttaccccaagtcactttcccgggaagccgtggcg
atctgcaaggggttcctaactaagcacccagcgaagcgcctgggctcagggccagacggg
gagcccgccatccgtgctcatggctttttccgctggatggactgggagcgcctggaacga
ctggagatcgcgcctccgttcagaccccgtccgtgtggacgcagcggtgagaacttcgac
aaattcttcacgcgggcggcgccagcgctgaccccgccagaccgcctagtgttggccagc
atcgaccaggccgatttccaaggcttcacctacgtgaacccggatttcgtgcacccggac
gcccgcagccccatcagcccaccgcctgtgccagtcatgtaa

DBGET integrated database retrieval system