KEGG   Ursus maritimus (polar bear): 103665908
Entry
103665908         CDS       T03271                                 

Gene name
AXIN2
Definition
(RefSeq) axin 2
  KO
K04385  axin 2
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04310  Wnt signaling pathway
umr04390  Hippo signaling pathway
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04934  Cushing syndrome
umr05010  Alzheimer disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05165  Human papillomavirus infection
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05213  Endometrial cancer
umr05217  Basal cell carcinoma
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103665908 (AXIN2)
   04390 Hippo signaling pathway
    103665908 (AXIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103665908 (AXIN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103665908 (AXIN2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103665908 (AXIN2)
   05225 Hepatocellular carcinoma
    103665908 (AXIN2)
   05226 Gastric cancer
    103665908 (AXIN2)
   05217 Basal cell carcinoma
    103665908 (AXIN2)
   05213 Endometrial cancer
    103665908 (AXIN2)
   05224 Breast cancer
    103665908 (AXIN2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103665908 (AXIN2)
   05022 Pathways of neurodegeneration - multiple diseases
    103665908 (AXIN2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103665908 (AXIN2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103665908 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:umr03036]
    103665908 (AXIN2)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103665908 (AXIN2)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD DUF4827
Other DBs
NCBI-GeneID: 103665908
NCBI-ProteinID: XP_008692163
UniProt: A0A384CBC6
LinkDB
Position
Un
AA seq 776 aa
MSSAVLVTRLPDPSSSFHEDAPRPPVPGEEGETPPCQPGAGKGQVTKPMPVSSNARRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLERDKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWACADLK
CKLSPTVVGLSSKTLRATANVRTTEAVENGYRSFRRSDPMNPYHVGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPVSIVWRG
RQILLAMLSLEDQGWEVERGRSRDEEKEASELALSSREGGPTPHPLSLLPSGSSHHHHHH
QQYHPLLPPGGKLPPVSASQPGCPLLGAKGFVTKQTTKHVHHHYTHHHALPKSKEEMEAE
AAQRVRCFCPGAAXXXXXXXXXSHSSRGSTLPKPSGRSVEPGLALPAREGGAPGGAGALQ
LPGEEGDRSQDVWQWMLESERQSKPKPPSAQSTKKAYPLESSRASPAERAGRHPLLGGSN
GHPRAAPRAHPFTQDPTMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCAAGQQRDRNHS
ATGQTGGAPFSSPSLASEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRMLKAQSLT
LGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWDDEAVLPMYEGRILGKVERID
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgagcagtgctgtgttggtgacccggctcccagaccccagcagcagcttccacgaggat
gccccccgacccccagtgccgggggaagaaggggagaccccgccgtgccagcccggggca
ggaaagggccaggtcaccaaacccatgcctgtctcctccaacgccaggcggaacgaggat
gggttgggggagcccgaggggcgggcgtccccggattcccctctgaccaggtggaccaag
tccttgcactccttgttgggcgatcaagatggtgcttatctcttccgcactttcctggag
agggacaaatgcgtggataccttagatttctggtttgcctgcaatgggttcaggcagatg
aacctaaaggataccaaaactttacgagtagccaaagcgatctacaaaaggtacattgag
aacaacagcatcgtctccaagcagctgaaacctgccaccaaaacctacataagagatggc
atcaagaagcaacagattgattccatcatgtttgaccaggcacagactgagatccagtcg
gtgatggaggaaaatgcctaccagatgtttttgacttctgatatatacctcgaatatgtg
aggagtgggggagaaaacacagcttacatgagtaacgggggactggggagcctcaaggtc
gtgtgtggctatctccccaccttgaacgaggaagaggagtgggcttgtgctgacttgaag
tgcaaactgtcacccactgtggttggcttgtccagcaaaactctgagggctacagcgaac
gtgaggaccaccgaggctgttgaaaatggatacaggtccttcaggaggagcgatcctatg
aatccataccacgtcggttctggctatgtctttgcaccggctaccagcgccaacgacagt
gagatatccagcgacgcgctgactgacgattccatgtccatgacggacagcagcgtagat
ggaatccctccttatcgtgtggggagtaagaaacagctgcagagagaaatgcatcgcagt
gtgaaggccaatggccaagtgtctctacctcatttcccggtgagtatagtctggagggga
aggcagatacttttggccatgttgagtcttgaagatcagggctgggaggtggagcggggg
aggtccagggatgaagagaaggaggcctccgagctagcgctgagctccagggaggggggg
cccacaccgcaccccctctccctcctgccctccggcagctctcaccaccaccaccaccac
cagcagtaccaccccctgctcccgcctgggggcaagctgcccccggtgtccgcctcgcaa
cccgggtgccccctcctcggagccaagggcttcgtgaccaagcagacaacgaagcatgtc
caccaccactacacacaccaccacgccctccccaagagcaaggaggaaatggaggcagag
gccgcacagcgggtgcgctgcttctgccccggggccgccgnnnnnnnnnnnnnnnnnnnn
nnnntctcccacagcagcagaggcagtaccctgcccaagccaagtgggagaagcgtggag
ccgggcctggccctgcctgccagggaaggaggggcccccggcggagctggggcgctgcag
cttcccggggaggaaggagacaggtcgcaggatgtgtggcagtggatgctggagagtgag
cggcagagcaaacccaagccccctagtgcccaaagcacaaaaaaggcttaccccttggag
tccagccgtgcgtcccccgccgagcgagccggccggcaccccctgctggggggcagcaac
gggcacccccgcgctgccccccgagcccacccgttcacccaggaccccacgatgcctccc
ctgacccctcccaacacgctggcacagctagaggaggcctgccgccggctggctgaggtg
tccaagcccccaaagcagcggtgctgtgcagccggtcagcagagagacaggaaccactcg
gccactggtcagacaggaggcgcgcccttctccagccccagcctggcttccgaagatcac
aaagagccgaagaagctggcgggggtccacgcgctccaggccagcgagttggtcgtcaca
tactttttctgtggagaagaaattccatacaggaggatgctgaaggctcagagcttgacc
ctgggccactttaaagagcagctcagcaaaaagggaaattataggtattacttcaaaaaa
gcaagcgacgagtttgcctgcggagccgtgtttgaggagatctgggacgatgaggcggtg
ctccccatgtacgaaggcaggattctggggaaagtggagaggatcgactga

KEGG   Ursus maritimus (polar bear): 103668450
Entry
103668450         CDS       T03271                                 

Gene name
AXIN1
Definition
(RefSeq) axin 1
  KO
K02157  axin 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04310  Wnt signaling pathway
umr04390  Hippo signaling pathway
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04934  Cushing syndrome
umr05010  Alzheimer disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05165  Human papillomavirus infection
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05213  Endometrial cancer
umr05217  Basal cell carcinoma
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103668450 (AXIN1)
   04390 Hippo signaling pathway
    103668450 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103668450 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103668450 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103668450 (AXIN1)
   05225 Hepatocellular carcinoma
    103668450 (AXIN1)
   05226 Gastric cancer
    103668450 (AXIN1)
   05217 Basal cell carcinoma
    103668450 (AXIN1)
   05213 Endometrial cancer
    103668450 (AXIN1)
   05224 Breast cancer
    103668450 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103668450 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    103668450 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103668450 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103668450 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:umr01009]
    103668450 (AXIN1)
Protein phosphatases and associated proteins [BR:umr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103668450 (AXIN1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind Sec16
Other DBs
NCBI-GeneID: 103668450
NCBI-ProteinID: XP_008694921
UniProt: A0A384CJ84
LinkDB
Position
Un
AA seq 831 aa
MNIQEQGFPLDLGTSFTEDAPRPPVPGEEGELVSTDPRPVSHSFCSGKGVGVKGETSAAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDFWFA
CSGFRKLEPCDSNEEKRLKLAKAIYRKYILDNSGIVSRQTKPATKSFIKDCIMKQLIDPA
MFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKLCSDQSSGSGTGKGIPGYLPT
LNEDEEWKCDQDQDEDGGRDPAPPGRLTQKLLLETAAPRASSSRRYSEGREFRCGSWREP
VNPYYVSSGYALAPATSANDSEQQSLSSDADSLSLTDSSVDGIPPYRIRKQHRREMQESV
QVNGRVPLPHIPRTYRMPKEIRVEPQKFAAELIHRLEAIQRTREAEEKLEERLKRVRMEE
EGEDGDLPSGPPGASHKLPLAPAWHHFPPRYADVGCMALRDAHEENPESILDEHVQRVMR
TPGCQSPGPGHRSPDSAHVPKIVGVLGGVPSGHGKHAPKSGAKLDTAGLHLHRHGHHHSH
HSAARPKEQADAEAARRGQGGFAWGPELHSHAAKPRSHSESMGAAPNASDSLAHSGKAGT
ASRRNAKKTESGKNAGTEVPGPSEDTEKNQKILQWIMEGEKEISRHRKAGHGSSGTKKQQ
THESSRPLSVERPGTVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLE
EEEKRASKLPSKQRTKSQRKAGSGSAQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFK
ELLTKKGNYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD
NT seq 2496 nt   +upstreamnt  +downstreamnt
atgaatatccaagagcagggtttccctttggaccttggaacaagtttcaccgaagatgcc
ccccgacccccagtgcctggtgaggagggtgaactggtgtccacagaccccaggcccgtc
agccacagcttctgctccgggaaaggtgtcggggttaaaggtgagacttcagcagccact
cccaggcgctcggatctggacctggggtacgagcctgagggcagcgcctcacccacccca
ccatacttgaagtgggccgagtcgctgcactccttactggacgatcaagacgggataaac
ctgtttcggactttcctgaagcaggaggactgtgctgacctgctggacttctggtttgcc
tgcagcggcttcaggaaactggagccctgtgactcgaatgaggagaagaggctgaagctg
gccaaagctatctaccgcaagtatatcctcgataacagcggcattgtgtccaggcagact
aagccggctaccaagagcttcataaaggactgcatcatgaagcagctcatcgatcctgcc
atgtttgaccaggcccagacggaaatccagtccaccatggaagaaaacacctacccctct
ttcctcaagtctgatatttatttggaatatacgaggacaggctcggagagcccgaagctc
tgtagtgaccagagctctgggtcagggacagggaagggcatacctggatatctgcccact
ctgaacgaagatgaggaatggaagtgtgaccaagaccaagacgaagatggtggcagagac
cctgctccccccggcaggctcacgcagaagctgcttctggagacggccgccccgcgggcc
tcctcaagtagacggtacagcgaaggcagagagttcaggtgcgggtcctggcgggagcct
gtcaacccctactatgtcagctccggctacgccctcgccccggccaccagtgccaacgac
agcgagcagcagagcctgtccagcgacgcggacagcctgtccctcaccgacagcagcgtg
gatggaatcccaccgtacaggatccgcaagcagcaccgccgggagatgcaggagagtgtc
caggtcaacgggcgggtgcctctacctcacattcctcgcacttaccgaatgccaaaggag
atccgtgtggagccccagaagttcgctgcggagctcatccaccgcctggaggccattcag
cggacacgggaggccgaggagaagctggaggagcggctgaaacgcgtccggatggaggaa
gaaggcgaggatggtgacctgccctccggccctcccggggccagtcataagctgcctttg
gcccctgcctggcaccacttcccaccccgctatgcagacgtgggctgcatggcgctgcgg
gacgcacacgaggagaaccccgagagcatcctggatgagcacgtgcagcgggtcatgagg
acgcctggctgtcagtcaccggggcccggccaccgttcccccgacagtgcgcacgtgccc
aagattgtgggggtgctggggggcgtgccctctgggcacggtaagcatgcacccaagtcg
ggggcgaagctggacacagctggcctgcacctccacaggcacggccaccaccacagtcac
cacagtgctgccaggcccaaggagcaggccgatgctgaggctgcccgccgagggcagggc
ggctttgcctggggcccagagctgcacagccacgcagccaagccccgcagccactcggag
agcatgggtgccgcccccaatgccagcgacagcctggcccacagcgggaaggctggcact
gcctctagaagaaatgccaagaagactgagtcggggaagaacgctggcaccgaggtgcca
ggcccgtcggaagacacggagaagaaccagaagatcctgcagtggatcatggagggggag
aaggagatcagccggcaccgcaaggctggccacgggtcttccggcaccaagaagcagcag
acgcacgagagctccaggcccttgtctgtcgagcgtcctgggaccgtgcacccttgggtc
agtgctcagctccggaactccgtccagccctcccacctcttcattcaagaccccaccatg
ccacccaacccggcccccaacccactgacccagctggaggaggcccgcaggcgtctggaa
gaggaggagaagagagccagcaagttaccctcaaagcagaggacgaagtcacagaggaag
gcgggcagtgggagtgcccagccgtgtgacagcattgtggtggcctactacttctgtggg
gagcccatcccctataggaccctggtgcggggccgcgcagtcaccctgggccagttcaag
gagctgctgaccaagaagggcaactacagatactacttcaagaaggtgagcgacgagttt
gactgtggagtggtgtttgaggaggttcgggaagacgaggccgtcctgcctgtctttgag
gagaagatcattggcaaggtggagaaggtggactga

DBGET integrated database retrieval system