KEGG   Ursus maritimus (polar bear): 103665978Help
Entry
103665978         CDS       T03271                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00052  Galactose metabolism
umr00500  Starch and sucrose metabolism
umr01100  Metabolic pathways
umr04142  Lysosome
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103665978 (GAA)
   00500 Starch and sucrose metabolism
    103665978 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103665978 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103665978 (GAA)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103665978 (GAA)
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103665978 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 103665978
NCBI-ProteinID: XP_008692233
UniProt: A0A384CBK6
LinkDB All DBs
Position
Un
AA seq 1155 aa AA seqDB search
MDVRWPPSSRPLLGVCTLVCLATAALLGHVLLRDFLVVPQEQRGFSRVPEELYHAPQQGA
RDPGPQPTPGHHGSPRAARTQCDVPPNSRFDCAPDKAVTQEQCEARGCCYRPARQWPRAP
RMGQPWCFFPPSYPSYKLENLTTTETGYRATLTRTTRTFFPKDILTLQLDLLLETESRLH
FTIKDPANRRYEVPLETPRVRSRALSTLYSVEFQEEPFGVVVRRKLDGRVLLNTTVAPLF
FADQFLQLSTSLPSRHLVGLAEHLGSLTLSTNWTKITLWNRDIAPSPNVNLYGSHPFYLV
LEDGGSAKPWVTPGLLSPDVVLQPSPALSWRSTGGILDVYVFLGPEPKRVVQQYLEVVGY
PFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRARFPLDTQWNDLDYMDARRDFTFNKDG
FRDFPAMVQELHQGGRHYVMIVDPAISSSGPPGSYRPYDDGLRRKVFITNETGQPLIGKV
WPGFTAFPDFTSPEALDWWQDMVSEFHAQVPFDGMWIDMNEPSNFVKGSVDGCPDNDLEN
PPYVPGVVGGTLQAATICTSSRQFLSTHYNLHNLYGLTEAFASHSLSPETLLTHVGREAR
GPLGTCAGGSLVWEAPQEAGSQLRAHPSLGLWFWRVLIVPWQRSCRSRDLLQARQGSPTA
GSGPAHGLVVPEETLREREGPAQAGPAEPWWGGPKLINLEPPDPSAAQGAPWPPSQYQLT
LGADGNRSVCSPSPGGLWSDSRCRRGHPSSSLPASGGGQQSSVSLVWGHPSRLHLRLCSA
FSPVSLVTVWAFSYSVTRQTGSGPPPVTSTELYLQRPSFQIRSLHKSGSALPEILLFNLL
GVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNDLKSLPQEPYRFSETAQEAMRK
ALALRYALLPFLYSLFHRAHVLGETVARPLFLEFPEDPRTWTVDRQLLWGAALLITPVLE
AGKVEVTGYFPPGTWYDLQAVPVEAFSSLPPPPWAPLTPVIHSKGQWVTLPAPLDTIKLH
LRAGHVIPLQGPGLTTMESRKQPMGLLAALTMNGEARGELFWDDGESLGVPERGDYTKVI
FLARNNTIMNELLHVTSEGAGLQLRKVTVLGVATAPSQVLSNGVPVSNFTYSPDTKTLDI
LVSLTMGEQFLISWS
NT seq 3468 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgaggtggcctcccagctcccgccccctcctgggggtctgcaccctcgtctgc
ctggccaccgctgccctcctggggcacgtcctgctccgtgatttcttggtggtcccccaa
gagcagcgtggcttctcccgagtacccgaggagctttatcatgctccccagcagggagcc
cgtgacccaggcccccagcccaccccagggcaccacggtagtccccgagcagcacgcaca
cagtgtgatgtgccccccaacagccgcttcgactgtgcccccgacaaggccgtcacccag
gaacagtgtgaggcccggggctgctgctaccggcctgcgaggcagtggcctcgggccccc
cggatggggcagccctggtgcttcttcccacccagctacccgagttacaagctggagaac
ctgaccaccacggagacgggctacagggccaccctgacccgcaccacccgaaccttcttc
cccaaggacatcttgaccttacagctggacctgctgctggagacggagagccggcttcac
ttcacgatcaaggatcccgccaacaggcgctacgaggtacccctggagaccccgcgtgtc
cgcagccgggccttgtccacactgtacagcgtggagttccaggaggagccctttggggtg
gtcgtgcgccggaagctggacggccgggtgctgctgaacacgacggtggcccccctgttc
ttcgccgaccagtttctgcagctgtccacatccctgccgtcccggcaccttgtgggcctt
gccgagcacctcggctccctcacgctcagcaccaactggaccaagatcactctctggaac
cgggacatcgccccctcgcccaacgtgaacctgtatgggtcccaccctttctacctggtg
ctggaggacggcgggtcagctaagccatgggtaaccccagggctgctttccccagacgtg
gtcctgcagccgagcccagccctcagctggaggtcgacaggtgggatcctggatgtgtac
gtcttcctgggccctgagcccaagcgcgtggtgcagcagtacctggaagtcgtgggctat
ccgttcatgccgccctactggggcctgggcttccacctgtgccgctggggctactcctcc
accgccatcacccgccaggtggtggagaacatgaccagggcccgcttccccctggacacg
cagtggaatgacctggactacatggacgccaggagggacttcaccttcaacaaggacggt
ttcagggacttcccggccatggtgcaggagctccaccagggtggccggcactacgtgatg
atcgtggaccctgccatcagtagctccggcccgcccggcagctaccgaccctatgacgac
ggtctgcggaggaaggttttcatcaccaacgagactgggcagcctctgattgggaaggtg
tggcccggattcactgccttccccgacttcaccagccccgaggccctggactggtggcag
gacatggtgtctgagttccacgcccaggtgccctttgacggcatgtggatcgacatgaac
gagccgtccaacttcgtaaagggctctgtggacggctgccctgacaatgacctggagaac
ccgccctacgtgccaggggtggtgggtgggaccctgcaggccgccaccatctgtacctcc
agccgccagttcctctccacacactacaacctgcacaacctatacggcctgacggaagcc
tttgcctcgcacagcctcagcccagagacgctgctgactcatgtggggcgagaggcccgc
gggcccctgggcacctgtgcggggggctcactcgtgtgggaggcccctcaggaggcaggt
tcccagctccgcgcccacccgagtcttgggctatggttctggcgtgtactgatcgtcccg
tggcagaggtcatgcaggtctcgggacctgctgcaagccaggcaagggtcccccacagct
gggtcgggacctgcccatgggctggtggtccctgaggagacactgagggagagggagggc
ccagcccaggctggtcctgctgagccgtggtggggtgggcccaaactgatcaacctggag
ccacctgacccttcagcggctcaaggggctccctggcctccttcccagtaccagctcaca
ctgggtgctgacggcaacagaagcgtgtgctctcccagccctggaggcttgtggtcggac
tcgcggtgtcggagggggcacccttcctcgagtctcccggcttctgggggtggccagcag
tcctcggtgtccttagtgtggggccatccctcccgtctccacctccgtctttgctcggcc
ttctcccccgtgtctcttgtcacggtctgggctttttcttactcggtcaccaggcagact
gggtcaggaccgcctccagtgacctcaactgaattgtatctgcaaagaccctcgttccaa
ataaggtcacttcacaagtctggctctgccctcccagaaatcctgctgttcaacctgctg
ggggtgccgctggtcggggccgacgtctgtggcttcctgggcaacacctcggaggagctg
tgtgtgcgctggacccagctgggggccttctacccgttcatgcggaatcataacgacctc
aaaagcctgcctcaggagccgtacaggttcagcgagacggcgcaggaagccatgcggaag
gccctcgccctgcgctacgcgctgctgcccttcctctactcgctgttccaccgggcccat
gtcctgggcgagactgtggcccggcccctcttcctggagttccctgaggacccccgcacc
tggaccgtggaccgccagctgctgtggggggcggctctgctcatcacccccgtgcttgag
gctgggaaggtcgaagtgactggctacttcccccccggcacgtggtacgacctgcaggcg
gtgccagtagaggccttcagcagcctcccacctccaccttgggctcccctcacgcccgtc
atccacagcaaggggcagtgggtgacgctgccggccccgctggacaccatcaagctccac
ctccgggcggggcacgtcatccccctgcagggccctggcctcacaaccatggagtcccgg
aagcagcccatgggcctgctcgcagccctgaccatgaacggggaggcccgaggggagctg
ttctgggatgacggggagagcctgggggtgccggagcgtggggactacacgaaggtcatc
ttcctggccaggaataacaccatcatgaacgagctgctgcacgtgactagtgagggggct
ggcctgcagctgaggaaggtgaccgtcctgggggtggccacggcccccagccaggtcctc
tccaatggcgtccctgtctccaacttcacctacagccccgacaccaagaccctggacatc
cttgtctcactgacgatgggagagcagtttctcatcagttggtcttaa

DBGET integrated database retrieval system