KEGG   Ursus maritimus (polar bear): 103666008
Entry
103666008         CDS       T03271                                 

Gene name
RAC3
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04071  Sphingolipid signaling pathway
umr04310  Wnt signaling pathway
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04510  Focal adhesion
umr04520  Adherens junction
umr04650  Natural killer cell mediated cytotoxicity
umr04662  B cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05135  Yersinia infection
umr05163  Human cytomegalovirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05231  Choline metabolism in cancer
umr05416  Viral myocarditis
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103666008 (RAC3)
   04014 Ras signaling pathway
    103666008 (RAC3)
   04015 Rap1 signaling pathway
    103666008 (RAC3)
   04310 Wnt signaling pathway
    103666008 (RAC3)
   04370 VEGF signaling pathway
    103666008 (RAC3)
   04071 Sphingolipid signaling pathway
    103666008 (RAC3)
   04024 cAMP signaling pathway
    103666008 (RAC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103666008 (RAC3)
   04520 Adherens junction
    103666008 (RAC3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103666008 (RAC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103666008 (RAC3)
   04662 B cell receptor signaling pathway
    103666008 (RAC3)
   04664 Fc epsilon RI signaling pathway
    103666008 (RAC3)
   04062 Chemokine signaling pathway
    103666008 (RAC3)
  09158 Development and regeneration
   04360 Axon guidance
    103666008 (RAC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103666008 (RAC3)
   05231 Choline metabolism in cancer
    103666008 (RAC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103666008 (RAC3)
   05212 Pancreatic cancer
    103666008 (RAC3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103666008 (RAC3)
   05416 Viral myocarditis
    103666008 (RAC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103666008 (RAC3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103666008 (RAC3)
   05163 Human cytomegalovirus infection
    103666008 (RAC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:umr04031]
    103666008 (RAC3)
GTP-binding proteins [BR:umr04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    103666008 (RAC3)
SSDB
Motif
Pfam: Ras Roc
Other DBs
NCBI-GeneID: 103666008
NCBI-ProteinID: XP_008692263
UniProt: A0A384CBN3
LinkDB
Position
Un
AA seq 157 aa
MHLRKSPHAGRKSRRPVSPSPPRSSPFSQQLVPPLSYPQTDVFLICFSLVSPASFENVRA
KWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYL
ECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF
NT seq 474 nt   +upstreamnt  +downstreamnt
atgcatctgaggaaaagcccccacgcgggaaggaagtccagaagacccgtgtccccctct
cccccccgctccagccccttctcgcaacagctcgtgccgccgctctcctacccccaaact
gacgtctttctgatctgcttctccctggtgagcccggcgtcctttgagaatgtgcgagcc
aagtggtacccagaggtgcgacaccactgcccccacactcccatcctcctggtgggcacc
aagctggacctccgtgacgacaaggacaccatcgaacggctgcgggacaagaagttggca
cctatcacctacccccagggcctggccatggcccgtgagattggctctgtcaagtacctg
gagtgctcagccctcactcagcggggcctgaagaccgtgtttgacgaggccatccgggct
gtgctctgcccacccccggtgaaaaagccggggaagaagtgcacggtcttctag

KEGG   Ursus maritimus (polar bear): 103670095
Entry
103670095         CDS       T03271                                 

Gene name
RAC1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04071  Sphingolipid signaling pathway
umr04145  Phagosome
umr04151  PI3K-Akt signaling pathway
umr04310  Wnt signaling pathway
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04380  Osteoclast differentiation
umr04510  Focal adhesion
umr04520  Adherens junction
umr04530  Tight junction
umr04620  Toll-like receptor signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr04662  B cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04670  Leukocyte transendothelial migration
umr04722  Neurotrophin signaling pathway
umr04810  Regulation of actin cytoskeleton
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04972  Pancreatic secretion
umr05014  Amyotrophic lateral sclerosis
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05100  Bacterial invasion of epithelial cells
umr05132  Salmonella infection
umr05135  Yersinia infection
umr05163  Human cytomegalovirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05205  Proteoglycans in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05212  Pancreatic cancer
umr05231  Choline metabolism in cancer
umr05416  Viral myocarditis
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103670095 (RAC1)
   04014 Ras signaling pathway
    103670095 (RAC1)
   04015 Rap1 signaling pathway
    103670095 (RAC1)
   04310 Wnt signaling pathway
    103670095 (RAC1)
   04370 VEGF signaling pathway
    103670095 (RAC1)
   04071 Sphingolipid signaling pathway
    103670095 (RAC1)
   04024 cAMP signaling pathway
    103670095 (RAC1)
   04151 PI3K-Akt signaling pathway
    103670095 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    103670095 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103670095 (RAC1)
   04520 Adherens junction
    103670095 (RAC1)
   04530 Tight junction
    103670095 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103670095 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103670095 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    103670095 (RAC1)
   04662 B cell receptor signaling pathway
    103670095 (RAC1)
   04664 Fc epsilon RI signaling pathway
    103670095 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    103670095 (RAC1)
   04670 Leukocyte transendothelial migration
    103670095 (RAC1)
   04062 Chemokine signaling pathway
    103670095 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    103670095 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103670095 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    103670095 (RAC1)
   04380 Osteoclast differentiation
    103670095 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103670095 (RAC1)
   05205 Proteoglycans in cancer
    103670095 (RAC1)
   05203 Viral carcinogenesis
    103670095 (RAC1)
   05231 Choline metabolism in cancer
    103670095 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103670095 (RAC1)
   05212 Pancreatic cancer
    103670095 (RAC1)
   05211 Renal cell carcinoma
    103670095 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103670095 (RAC1)
   05020 Prion disease
    103670095 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    103670095 (RAC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103670095 (RAC1)
   05416 Viral myocarditis
    103670095 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103670095 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103670095 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103670095 (RAC1)
   05135 Yersinia infection
    103670095 (RAC1)
   05100 Bacterial invasion of epithelial cells
    103670095 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103670095 (RAC1)
   05163 Human cytomegalovirus infection
    103670095 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103670095 (RAC1)
   05169 Epstein-Barr virus infection
    103670095 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103670095 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103670095 (RAC1)
   04031 GTP-binding proteins [BR:umr04031]
    103670095 (RAC1)
Membrane trafficking [BR:umr04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    103670095 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    103670095 (RAC1)
  Macropinocytosis
   Ras GTPases
    103670095 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    103670095 (RAC1)
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103670095 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   103670095 (RAC1)
  Exosomal proteins of colorectal cancer cells
   103670095 (RAC1)
  Exosomal proteins of bladder cancer cells
   103670095 (RAC1)
GTP-binding proteins [BR:umr04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    103670095 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 103670095
NCBI-ProteinID: XP_008696708
UniProt: A0A384CPH1
LinkDB
Position
Un
AA seq 193 aa
MGVTYTILFSLFRAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTA
GQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDL
RDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP
PPVKKRKRKCLLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atgggagtaacttacaccattcttttctctctctttagagctgtaggtaaaacttgccta
ctgatcagttatacaaccaatgcatttcctggagaatacatccccactgtctttgacaac
tactccgccaatgttatggtagatggaaaacccgtgaatctgggcttatgggatacagct
ggacaagaagattatgaccgattacgtcccttatcctacccgcaaacagatgtattctta
atttgcttttctcttgtgagtcctgcatcatttgaaaacgttcgagcaaagtggtacccc
gaagtgcgacaccactgtcccaacacccccatcatcttggtggggactaaacttgatctc
agggatgataaagacacgatcgagaagctgaaggaaaagaagctgactcccatcacctac
ccgcagggtctggccatggctaaggagatcggtgcggtaaaatacctggagtgctcggcg
ctcacgcagcgaggcctcaagacagtgtttgatgaagcgattcgagcggttctctgtcct
cctcccgtcaagaagaggaagagaaaatgcctgctgttgtaa

KEGG   Ursus maritimus (polar bear): 103674825
Entry
103674825         CDS       T03271                                 

Gene name
RHOA
Definition
(RefSeq) ras homolog family member A
  KO
K04513  Ras homolog gene family, member A
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04144  Endocytosis
umr04150  mTOR signaling pathway
umr04270  Vascular smooth muscle contraction
umr04310  Wnt signaling pathway
umr04350  TGF-beta signaling pathway
umr04360  Axon guidance
umr04510  Focal adhesion
umr04520  Adherens junction
umr04530  Tight junction
umr04611  Platelet activation
umr04621  NOD-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04660  T cell receptor signaling pathway
umr04670  Leukocyte transendothelial migration
umr04722  Neurotrophin signaling pathway
umr04810  Regulation of actin cytoskeleton
umr04921  Oxytocin signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr04972  Pancreatic secretion
umr05100  Bacterial invasion of epithelial cells
umr05132  Salmonella infection
umr05133  Pertussis
umr05135  Yersinia infection
umr05152  Tuberculosis
umr05163  Human cytomegalovirus infection
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103674825 (RHOA)
   04015 Rap1 signaling pathway
    103674825 (RHOA)
   04310 Wnt signaling pathway
    103674825 (RHOA)
   04350 TGF-beta signaling pathway
    103674825 (RHOA)
   04072 Phospholipase D signaling pathway
    103674825 (RHOA)
   04071 Sphingolipid signaling pathway
    103674825 (RHOA)
   04024 cAMP signaling pathway
    103674825 (RHOA)
   04022 cGMP-PKG signaling pathway
    103674825 (RHOA)
   04150 mTOR signaling pathway
    103674825 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103674825 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103674825 (RHOA)
   04520 Adherens junction
    103674825 (RHOA)
   04530 Tight junction
    103674825 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103674825 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103674825 (RHOA)
   04621 NOD-like receptor signaling pathway
    103674825 (RHOA)
   04625 C-type lectin receptor signaling pathway
    103674825 (RHOA)
   04660 T cell receptor signaling pathway
    103674825 (RHOA)
   04670 Leukocyte transendothelial migration
    103674825 (RHOA)
   04062 Chemokine signaling pathway
    103674825 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103674825 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    103674825 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103674825 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    103674825 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103674825 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    103674825 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103674825 (RHOA)
   05206 MicroRNAs in cancer
    103674825 (RHOA)
   05205 Proteoglycans in cancer
    103674825 (RHOA)
   05203 Viral carcinogenesis
    103674825 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103674825 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103674825 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103674825 (RHOA)
   05135 Yersinia infection
    103674825 (RHOA)
   05133 Pertussis
    103674825 (RHOA)
   05152 Tuberculosis
    103674825 (RHOA)
   05100 Bacterial invasion of epithelial cells
    103674825 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103674825 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103674825 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103674825 (RHOA)
   04031 GTP-binding proteins [BR:umr04031]
    103674825 (RHOA)
Membrane trafficking [BR:umr04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    103674825 (RHOA)
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103674825 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   103674825 (RHOA)
  Exosomal proteins of colorectal cancer cells
   103674825 (RHOA)
  Exosomal proteins of bladder cancer cells
   103674825 (RHOA)
GTP-binding proteins [BR:umr04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    103674825 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 103674825
NCBI-ProteinID: XP_008702012
UniProt: A0A384D4K7
LinkDB
Position
Un
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgt
ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag
aactatgtggcagatattgaagttgatgggaagcaggtagagttggctttgtgggataca
gctgggcaggaagattatgatcgcttgaggcctctctcctatccggacactgatgttata
ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggacc
ccggaagtcaagcacttctgtcccaacgtacccatcatcctggttgggaacaagaaggac
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccagtgaaa
ccggaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

KEGG   Ursus maritimus (polar bear): 103676407
Entry
103676407         CDS       T03271                                 

Gene name
RAC2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04071  Sphingolipid signaling pathway
umr04310  Wnt signaling pathway
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04510  Focal adhesion
umr04520  Adherens junction
umr04650  Natural killer cell mediated cytotoxicity
umr04662  B cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04670  Leukocyte transendothelial migration
umr04810  Regulation of actin cytoskeleton
umr05020  Prion disease
umr05135  Yersinia infection
umr05163  Human cytomegalovirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05231  Choline metabolism in cancer
umr05416  Viral myocarditis
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103676407 (RAC2)
   04014 Ras signaling pathway
    103676407 (RAC2)
   04015 Rap1 signaling pathway
    103676407 (RAC2)
   04310 Wnt signaling pathway
    103676407 (RAC2)
   04370 VEGF signaling pathway
    103676407 (RAC2)
   04071 Sphingolipid signaling pathway
    103676407 (RAC2)
   04024 cAMP signaling pathway
    103676407 (RAC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103676407 (RAC2)
   04520 Adherens junction
    103676407 (RAC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103676407 (RAC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103676407 (RAC2)
   04662 B cell receptor signaling pathway
    103676407 (RAC2)
   04664 Fc epsilon RI signaling pathway
    103676407 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    103676407 (RAC2)
   04670 Leukocyte transendothelial migration
    103676407 (RAC2)
   04062 Chemokine signaling pathway
    103676407 (RAC2)
  09158 Development and regeneration
   04360 Axon guidance
    103676407 (RAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103676407 (RAC2)
   05231 Choline metabolism in cancer
    103676407 (RAC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103676407 (RAC2)
   05212 Pancreatic cancer
    103676407 (RAC2)
  09164 Neurodegenerative disease
   05020 Prion disease
    103676407 (RAC2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103676407 (RAC2)
   05416 Viral myocarditis
    103676407 (RAC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103676407 (RAC2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103676407 (RAC2)
   05163 Human cytomegalovirus infection
    103676407 (RAC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:umr04031]
    103676407 (RAC2)
GTP-binding proteins [BR:umr04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    103676407 (RAC2)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 103676407
NCBI-ProteinID: XP_008703802
UniProt: A0A384D9T5
LinkDB
Position
Un
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIERLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRPQKRPCSIL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagatggagccgtgggcaaaacgtgccttctt
atcagctacaccaccaacgctttcccaggagagtacatccccaccgtgttcgacaactat
tcggccaatgtgatggtggacagcaagccggtgaacctggggctgtgggacacggcgggg
caggaggactacgaccgcttgcggccgctctcctacccacagacggacgtcttcctcatc
tgcttctcccttgtcagccctgcgtcctatgagaatgtccgtgccaagtggttccccgag
gtgcggcaccactgccccagcacacccatcatcctggtgggcaccaagctggatctgcgg
gacgacaaggacaccatcgagaggctgaaggagaagaagctggcgcccattacctacccg
cagggcctggcactggccaaggagatcgactcggtaaaatacctggagtgctcggccctc
acccagcgaggcctgaagaccgtctttgatgaggcgatccgggccgtcctgtgcccccag
cccacgcggccacagaagcgtccctgcagcatcctgtag

DBGET integrated database retrieval system