KEGG   Ursus maritimus (polar bear): 103666011
Entry
103666011         CDS       T03271                                 

Gene name
RFNG
Definition
(RefSeq) RFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  KO
K05948  fringe [EC:2.4.1.222]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00514  Other types of O-glycan biosynthesis
umr04330  Notch signaling pathway
umr05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    103666011 (RFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103666011 (RFNG)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103666011 (RFNG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103666011 (RFNG)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     103666011 (RFNG)
Glycosyltransferases [BR:umr01003]
 Glycan extension
  O-Glycan
   103666011 (RFNG)
SSDB
Motif
Pfam: Fringe
Other DBs
NCBI-GeneID: 103666011
NCBI-ProteinID: XP_008692265
UniProt: A0A384CCW6
LinkDB
Position
Un
AA seq 292 aa
MGSTAPCNTGSHLGTRTGLPRKGEKPSPCPESGSAREQAWPQLHQETPGTVAGATLLSPP
SQPQASRTVLGTLFSSQSSSPEAQAHPLASLRLRPGPPGVSQVVSPQTFIFTDGDDPELQ
LQEGSHVINTNCSAVHTRQALCCKMSVEYDKFIESGRKWFCHVDDDNYVNPKGLLRLLST
FSPSQDVYLGRPSLDHPIEAAERVQGGGTVTTVKFWFATGGAGFCLSRGLALKMSPWVTL
SYGGPENPHNVVNVMGGFSLQQDPTRFKSVHCLLYPDTDWCPVHKQSDLVSR
NT seq 879 nt   +upstreamnt  +downstreamnt
atgggctccacggccccctgcaacacaggcagccaccttggcactcgaaccggactgccc
aggaagggcgagaaaccctcaccgtgccctgagtcgggctctgcccgcgagcaggcctgg
ccccaactgcaccaggagacgccagggacagtagcgggcgccaccctcctctctccccca
tcccaaccccaagcgtccaggaccgtcctgggtaccctcttctcatcccaaagctccagc
cctgaagcccaggctcacccgctggcatctctgcggctccgtcctggtccacctggggtc
tcacaggttgtctctccccagacgttcatcttcacggatggggatgaccctgagcttcaa
ctccaggaaggcagccatgtaatcaataccaactgttccgctgtgcacacccgccaggca
ctgtgctgcaagatgtcggtggagtacgacaagttcatcgagtcgggccgcaagtggttc
tgccatgtggatgatgacaactatgtgaaccccaaaggcctgctccggctgctctccacc
ttctcgcccagccaggatgtctacctggggcggcccagcttggaccaccccatcgaggcc
gccgagagggtccagggaggaggcactgtgaccactgtcaagttctggtttgctacgggc
ggggccgggttctgcctgagcagaggcctcgctctgaagatgagcccctgggtcaccttg
agttacgggggtccagaaaacccacataatgtcgtgaatgtgatgggaggcttcagtctg
cagcaggaccccacacggttcaagtctgtccactgccttctgtacccagatacggattgg
tgtcctgtgcacaagcagagtgacctcgtttctcggtga

KEGG   Ursus maritimus (polar bear): 103670070
Entry
103670070         CDS       T03271                                 

Gene name
LFNG
Definition
(RefSeq) LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  KO
K05948  fringe [EC:2.4.1.222]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00514  Other types of O-glycan biosynthesis
umr04330  Notch signaling pathway
umr05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    103670070 (LFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103670070 (LFNG)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103670070 (LFNG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103670070 (LFNG)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     103670070 (LFNG)
Glycosyltransferases [BR:umr01003]
 Glycan extension
  O-Glycan
   103670070 (LFNG)
SSDB
Motif
Pfam: Fringe Galactosyl_T
Other DBs
NCBI-GeneID: 103670070
NCBI-ProteinID: XP_008696684
UniProt: A0A384CQC8
LinkDB
Position
Un
AA seq 388 aa
MAGLDFHVNGPGAAWLVAGNSALPNKAGFSAGVRGGHKSSPRPRPFGPGIVPKSAALPFW
ELQWREGTFAKCLVPPSVPQGPHVPPSFRPDCRLHQGRCWPVASEARLPESRFQDSISPA
SSPRRGPHGACVQQWGAHTGGAREEVASCGSSSSGRCLGLLVRGVFIAVKTTRKFHRARL
DLLLETWISRHKEMTFIFTDGDDEALARRTGNVVNTNCSAAHSRQALSCKMAVEYDHFIE
SGRKWFCHVDDDNYVNVRALLRLLASYPHTQDVYIGKPSLDRPIQATERVSENKMRPVHF
WFATGGGGALGVPLIRSGLFHSHLENLQQVPASELHEQVTLSYGMFESKRNAILVKGPFS
VEADPSRFRSIHCHLYPDTPWCPHTAVF
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggcaggtctggatttccatgtcaatgggccgggcgctgcctggctggtcgccggtaac
tcggccttgcccaacaaggctggtttctctgctggggtcagaggaggccataaatccagc
ccccggccccggccctttggccctggcattgtccccaagtctgcagccctccccttctgg
gaactccagtggcgggaagggacctttgccaagtgcctggtgcctcccagcgtgccccaa
ggaccccatgtgccgccctccttccgtccagactgccggctccaccaggggcgctgctgg
cctgtggcaagcgaggccagactcccggagtcccgattccaggactccatcagcccggcc
tctagtccccggcgtggtccccacggtgcgtgcgtccagcaatggggagctcacaccggc
ggtgcccgcgaggaagtggccagctgcggctccagctccagcggacgctgcctggggctc
ctggtccggggcgtcttcatcgcggtcaagaccaccagaaagtttcaccgcgcgcgcctc
gacctgctgctggagacctggatctcccgccacaaggagatgacgttcattttcaccgac
ggggacgatgaagccctggccaggcgcacgggcaacgtggtcaacaccaactgctcggcc
gcgcacagccgccaggcgttgtcctgcaagatggccgtggagtatgaccacttcatcgaa
tccgggaggaagtggttctgccacgtggacgacgacaactacgtgaacgtcagggctttg
ctgcggctgctggccagctacccgcacacgcaggacgtgtacatcggcaagcccagcctg
gacaggcctatccaggccacggagagggtcagcgagaacaagatgcgccctgtccacttc
tggtttgccactggcgggggtggggctctgggcgtgcccctcatccgcagcgggctcttc
cactcccacctggagaacctgcagcaggtgcccgcctccgagctccacgagcaggtgacc
ctcagctacggcatgtttgagagtaagcggaatgccatcctcgtgaaggggcccttctca
gtggaggctgacccgtccaggtttcgctccatccactgccacctgtacccggacacaccg
tggtgtccccacaccgccgtcttctag

KEGG   Ursus maritimus (polar bear): 103676401
Entry
103676401         CDS       T03271                                 

Gene name
MFNG
Definition
(RefSeq) MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  KO
K05948  fringe [EC:2.4.1.222]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00514  Other types of O-glycan biosynthesis
umr04330  Notch signaling pathway
umr05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    103676401 (MFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103676401 (MFNG)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103676401 (MFNG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103676401 (MFNG)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     103676401 (MFNG)
Glycosyltransferases [BR:umr01003]
 Glycan extension
  O-Glycan
   103676401 (MFNG)
SSDB
Motif
Pfam: Fringe Galactosyl_T Glycos_transf_2
Other DBs
NCBI-GeneID: 103676401
NCBI-ProteinID: XP_008703799
UniProt: A0A384DAJ0
LinkDB
Position
Un
AA seq 321 aa
MQCRLLRGLAGALLTLLCMGLLSLRYHSSLYPRGVRETPGLSPPSPLSPELRLHDVFIAV
KTTRAFHRSRLELLLDTWVSRTREQTFVFTDSPEEALQERLGSHLVVTNCSAEHSHPALS
CKMAAEFDTFLASGLWWFCHVDDDNYVNPRALLKLLKAFPQTHDVYVGRPSLNRPIRASE
PRPHNRTRLVQFWFATGGAGFCINRKLALKMAPWASGSRFVETSALIRLPDDCTVGYIVE
CKLGGRLQPSPLFHSHLETLQLLGAAHLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSR
FRSLHCLLYPDTPWCPQLMAR
NT seq 966 nt   +upstreamnt  +downstreamnt
atgcagtgccgcctcctccggggcctggccggagccctcctcacccttctgtgcatgggg
ctcctctccctacggtaccactcgagcctgtacccacggggcgtgcgggagaccccgggg
ctgagcccgccaagccctctgtcccctgagctgcggctgcacgatgtcttcattgcagtc
aagacgacccgagccttccaccgctcccgcctggagctgctgctcgacacgtgggtctcc
aggaccagggaacagacatttgtcttcaccgacagcccagaggaagccctccaggagaga
ctggggtcccacctcgtggtcaccaactgttctgctgagcacagccaccctgccctgtcc
tgcaagatggctgctgagtttgacaccttcttggccagcgggctgtggtggttctgccac
gtggatgacgacaactatgtgaacccaagggcattgctgaagctgctgaaagccttccct
cagactcacgacgtctacgtaggccggcccagcctgaaccggcctatccgcgcttctgag
ccgaggccccacaaccgcacgaggctggtacagttctggtttgccacggggggtgctggc
ttctgcatcaaccgcaaactggctttgaagatggccccgtgggccagtggctcccgcttc
gtggaaacgtccgccctcatccggttgcctgacgactgcactgtgggttacatcgtcgag
tgcaagctaggcggccgcctgcagcccagccccctcttccactctcacctggagaccctg
cagctgctgggggctgcccacctcccagaacaggtcaccctcagctatggtgtctttgag
gggaagctcaatgtcattaagctacaaggccccttctcacctgaagaggacccatccagg
ttccgttccctccattgtctcctctacccagatactccttggtgtccacagctgatggcc
agatga

DBGET integrated database retrieval system