KEGG   Ursus maritimus (polar bear): 103666055
Entry
103666055         CDS       T03271                                 

Gene name
NFKBIA
Definition
(RefSeq) NFKB inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04064  NF-kappa B signaling pathway
umr04210  Apoptosis
umr04380  Osteoclast differentiation
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04623  Cytosolic DNA-sensing pathway
umr04625  C-type lectin receptor signaling pathway
umr04657  IL-17 signaling pathway
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04668  TNF signaling pathway
umr04722  Neurotrophin signaling pathway
umr04920  Adipocytokine signaling pathway
umr04926  Relaxin signaling pathway
umr04931  Insulin resistance
umr05132  Salmonella infection
umr05134  Legionellosis
umr05135  Yersinia infection
umr05140  Leishmaniasis
umr05142  Chagas disease
umr05145  Toxoplasmosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05215  Prostate cancer
umr05220  Chronic myeloid leukemia
umr05222  Small cell lung cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103666055 (NFKBIA)
   04668 TNF signaling pathway
    103666055 (NFKBIA)
   04024 cAMP signaling pathway
    103666055 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103666055 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103666055 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    103666055 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    103666055 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    103666055 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    103666055 (NFKBIA)
   04660 T cell receptor signaling pathway
    103666055 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    103666055 (NFKBIA)
   04659 Th17 cell differentiation
    103666055 (NFKBIA)
   04657 IL-17 signaling pathway
    103666055 (NFKBIA)
   04662 B cell receptor signaling pathway
    103666055 (NFKBIA)
   04062 Chemokine signaling pathway
    103666055 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103666055 (NFKBIA)
   04926 Relaxin signaling pathway
    103666055 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103666055 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103666055 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103666055 (NFKBIA)
   05203 Viral carcinogenesis
    103666055 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103666055 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    103666055 (NFKBIA)
   05215 Prostate cancer
    103666055 (NFKBIA)
   05222 Small cell lung cancer
    103666055 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103666055 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103666055 (NFKBIA)
   05135 Yersinia infection
    103666055 (NFKBIA)
   05134 Legionellosis
    103666055 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103666055 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    103666055 (NFKBIA)
   05161 Hepatitis B
    103666055 (NFKBIA)
   05160 Hepatitis C
    103666055 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    103666055 (NFKBIA)
   05164 Influenza A
    103666055 (NFKBIA)
   05162 Measles
    103666055 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    103666055 (NFKBIA)
   05163 Human cytomegalovirus infection
    103666055 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103666055 (NFKBIA)
   05169 Epstein-Barr virus infection
    103666055 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103666055 (NFKBIA)
   05140 Leishmaniasis
    103666055 (NFKBIA)
   05142 Chagas disease
    103666055 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103666055 (NFKBIA)
   04131 Membrane trafficking [BR:umr04131]
    103666055 (NFKBIA)
Transcription factors [BR:umr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    103666055 (NFKBIA)
Membrane trafficking [BR:umr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    103666055 (NFKBIA)
SSDB
Motif
Pfam: Ank Ank_2 Ank_5 Ank_3 Ank_4
Other DBs
NCBI-GeneID: 103666055
NCBI-ProteinID: XP_008692311
UniProt: A0A384CBT6
LinkDB
Position
Un
AA seq 253 aa
MHSPALGVFPSLPLRFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVIT
NQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLYSILQATNY
NGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCGA
DVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDELP
YDDCVLGGQRLTL
NT seq 762 nt   +upstreamnt  +downstreamnt
atgcactcaccagccctgggggtttttccctctcttccccttaggttcctgcacttggcc
atcatccatgaagagaaggcactgaccatggaagtgatccgccaagtgaagggcgacctg
gccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatcacc
aaccaaccagaaatcgctgaggcacttctggaagctggctgtgatcctgagctccgagac
tttcgaggaaatacccccctacaccttgcctgtgagcaaggctgcctcgccagtgtggga
gtcctgactcagacctgcaggacccagcacctctactccatcctccaggccaccaactac
aatggtcacacgtgtctacatttggcctctatccatggttacttgggcatcgtggagctt
ttggtgtctttgggtgctgatgtcaatgctcaggagccctgtaatggtcgaacagccctc
catcttgcagtggacctgcagaattctgacctcgtgtcactcttgttgaagtgcggggct
gacgtcaaccgagtcacctaccagggctactccccataccagctcacctggggccgccca
agcacgcggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctgccg
gagagtgaggatgaggagagctacgacacggagtcagagttcacggaagacgagctaccc
tatgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system