KEGG   Ursus maritimus (polar bear): 103666330
Entry
103666330         CDS       T03271                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin 3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04060  Cytokine-cytokine receptor interaction
umr04151  PI3K-Akt signaling pathway
umr04210  Apoptosis
umr04630  JAK-STAT signaling pathway
umr04640  Hematopoietic cell lineage
umr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103666330 (IL3RA)
   04151 PI3K-Akt signaling pathway
    103666330 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103666330 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103666330 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103666330 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103666330 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:umr04050]
    103666330 (IL3RA)
   04090 CD molecules [BR:umr04090]
    103666330 (IL3RA)
Cytokine receptors [BR:umr04050]
 Interleukin receptor families
  IL3 receptor family
   103666330 (IL3RA)
CD molecules [BR:umr04090]
 Proteins
  103666330 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 103666330
NCBI-ProteinID: XP_008692557
UniProt: A0A384CCL6
LinkDB
Position
Un
AA seq 563 aa
MALLWLAVCLTSSVSGLLQTEEDPDSPIKNLRMEPGEKRLTWDLHGNVSEIMCFINSKFI
TKAINNNRYCQFQVLSSCEVKNFTVSLTKGPPFLMGIQYPLQEGNPGASAQRLDCWVHDM
DFLTCSWEVGREAPSDIQYRLYRQHLWTRREQECPHYERDNRGKHVRCHFNDVPRLEKQL
QILVRGTSQRATIPCSDRTVELSEIEKLNPPNITGTCNKSYSMMEWKVSSHFNRRYEYEL
QIQKGSDPAYTEKLQENFFALYNPGNYMARLKVKGFFRNTWSEWSAPQHFGLGSLKEEGV
RTQIQTEGRPREDTGRTRGLQAKKRDLRCNQPRSRLDVRLPASRTMKPEISVVPIALSVG
LGCGSPRKLTDAPQGPAVAPGSLRSLQIGAPGRCPRPHPTPAVAEWGSYLLDGNTTRAQA
AADLAVGAGSGDQPPRPTQGLGLESSLHPGVRRPLSSGFRACGSLCPLRYSVLQKLFPPI
PHMKDPTIDNLQSSKLAAKAWSPSDPRAQDWPGPCGFQGDGGVPSLASLQLCLAPSSPQV
AWEASRASREDCPVAEVQVLGET
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggccttgctgtggctcgcggtgtgtctgacgtcgtctgtctcgggtctgctgcaaacg
gaggaagatcccgattccccgattaagaacctaaggatggagccgggagaaaagagattg
acttgggacctccatggaaatgtttctgaaattatgtgtttcataaattcaaaatttatc
actaaggcaatcaacaacaaccgttactgccagttccaagtgctttcctcatgtgaagtg
aaaaacttcaccgtctccttgaccaaaggcccaccgttcttgatggggattcagtatcct
ctgcaagaaggaaaccctggggcatctgcacaacgtctggactgctgggtgcacgacatg
gacttcctgacgtgcagctgggaggtgggcagggaggcccccagtgacatccagtatcgc
ctgtacaggcagcacctgtggacccgcagggagcaggagtgtccgcattatgaaagggac
aatcgggggaaacacgtccggtgtcatttcaatgacgtccccagattggagaaacagctc
cagattctggtgagaggcaccagccaacgtgccacgatcccctgctcggaccgtactgtc
gaattatcagaaattgagaaattaaatccacccaatatcactggcacgtgtaataagtca
tattcgatgatggaatggaaagtgtcaagtcacttcaatcgcagatatgagtatgaactt
caaatacaaaagggcagcgatcccgcctacacagagaagctccaggaaaacttcttcgcg
ctttacaatcccggaaactacatggcgagactaaaggtgaaaggtttcttccgcaacacc
tggagcgaatggagtgccccccaacactttggactggggtccttgaaagaagagggcgtg
agaacacagatacagacagagggacgaccgcgtgaggacacggggagaacacggggtcta
caggccaagaagagagacctcaggtgcaaccagcctcggtcccgcctggatgtcagactt
ccagcctccaggacaatgaaaccagaaatatctgttgttccaatcgccctgtctgtggga
cttggttgtggcagccccagaaaactcacagacgccccacagggccccgctgtcgccccg
gggagcctgaggtctttgcagatcggtgcgcccgggcgctgtccccgtccccaccccacc
cccgccgtggccgagtgggggtcttacctgctggacggcaacaccaccagggcgcaggct
gcagccgacttggccgtgggggcgggcagtggagaccagccgcccagacccacccaggga
ctggggctggagtcctcactccatcccggcgtccggaggcccctgagttctggattcaga
gcttgtggttctctctgtcctctgaggtactcggttttgcagaaactcttccctcccatc
cctcacatgaaagaccccaccattgacaatcttcagagcagcaagttggcagccaaggcc
tggagccccagcgacccgcgtgcccaggactggccaggcccctgcggctttcagggtgat
ggaggggtaccctcgttggcgagtctgcagctctgcctggccccgtcgtccccgcaggtg
gcctgggaggccagcagagcaagccgggaggactgcccggtggcggaagtgcaggttttg
ggagaaacatga

DBGET integrated database retrieval system