KEGG   Ursus maritimus (polar bear): 103666443Help
Entry
103666443         CDS       T03271                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04110  Cell cycle
umr04213  Longevity regulating pathway - multiple species
umr04330  Notch signaling pathway
umr04919  Thyroid hormone signaling pathway
umr05016  Huntington's disease
umr05034  Alcoholism
umr05165  Human papillomavirus infection
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05203  Viral carcinogenesis
umr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:umr00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    103666443 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    103666443 (HDAC1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    103666443 (HDAC1)
  Aging
   04213 Longevity regulating pathway - multiple species
    103666443 (HDAC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    103666443 (HDAC1)
   05202 Transcriptional misregulation in cancers
    103666443 (HDAC1)
   05203 Viral carcinogenesis
    103666443 (HDAC1)
   05220 Chronic myeloid leukemia
    103666443 (HDAC1)
  Neurodegenerative diseases
   05016 Huntington's disease
    103666443 (HDAC1)
  Substance dependence
   05034 Alcoholism
    103666443 (HDAC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    103666443 (HDAC1)
   05165 Human papillomavirus infection
    103666443 (HDAC1)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103666443 (HDAC1)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     103666443 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     103666443 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    103666443 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    103666443 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103666443
NCBI-ProteinID: XP_008692691
LinkDB All DBs
Position
Un
AA seq 482 aa AA seqDB search
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVISKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQVIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNASNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKQEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactcagggcaccaggaggaaagtctgttactactacgacggggatgttgga
aattactactatggacaaggccacccaatgaagcctcaccgaatccgcatgactcacaat
ttgctacttaactatggtctctaccgaaaaatggaaatctatcgcccgcacaaagccaat
gctgaggagatgaccaagtaccacagcgacgactacattaaattcctgcgctccatccgc
ccagataacatgtccgagtacagcaagcagatgcagagattcaacgtcggtgaggactgt
ccagtatttgatggcctgtttgaattctgtcagttatctactgggggctctgtggcgagt
gctgtgaaactgaataagcagcagacggacatcgccgtgaattgggccgggggcctgcac
cacgcaaagaagtctgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggagctgctaaagtatcaccagagggtgctgtatattgacattgatattcaccacggc
gatggcgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataaa
tacggagagtacttcccaggaactggcgacctacgggacattggggctggcaaaggcaag
tattacgctgttaactacccgctccgagatgggatcgatgacgagtcctatgaggccatt
ttcaagccggtcatatctaaagtgatggagatgttccagcccagtgcggttgtcttacag
tgtggctctgactccctttctggggatcggttaggttgcttcaatctgaccatcaaaggg
catgccaagtgtgtggagtttgtgaagagcttcaacctgcctatgctgatgctgggcgga
ggcggctacaccatccgtaacgtggcccgctgctggacgtacgaaacggctgtggccctg
gacacggagatcccgaatgaacttccgtacaacgactacttcgaatactttgggccagat
ttcaaacttcacatcagtccttccaatatgaccaaccagaataccaatgaatacctggag
aagatcaaacagcgactgtttgagaacctgagaatgctgccccacgcacctggggtccaa
atgcaggtgattcctgaggatgccattccagaggagagtggcgacgaggacgaagaagac
cctgacaagcgtatctcgatctgttcttctgacaagcgaattgcctgtgaggaagagttc
tcagactccgatgaggagggagaaggtggtcgcaagaacgcttccaacttcaaaaaagcc
aagagagtcaaaactgaggatgaaaaagagaaagacccagaagagaagaaagaagtcaca
gaagaggagaaaaccaaggaggagaagcaagaagccaaaggggtcaaggaggaggtcaag
ttggcttga

DBGET integrated database retrieval system