KEGG   Ursus maritimus (polar bear): 103666614Help
Entry
103666614         CDS       T03271                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00020  Citrate cycle (TCA cycle)
umr00190  Oxidative phosphorylation
umr01100  Metabolic pathways
umr01200  Carbon metabolism
umr04714  Thermogenesis
umr04932  Non-alcoholic fatty liver disease (NAFLD)
umr05010  Alzheimer disease
umr05012  Parkinson disease
umr05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103666614 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103666614 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    103666614 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    103666614 (SDHB)
   05012 Parkinson disease
    103666614 (SDHB)
   05016 Huntington disease
    103666614 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103666614 (SDHB)
Enzymes [BR:umr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103666614 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-GeneID: 103666614
NCBI-ProteinID: XP_008692900
UniProt: A0A384CER2
LinkDB All DBs
Position
Un
AA seq 280 aa AA seqDB search
MAAVVGVSLKRRFPAAALGGACLQACRGVQTAAATAPRIKKFAIYRWDPDKTGDKPRMQT
YEIDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYTGKKASV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcggagtctccttgaagcgccggttcccggctgcagcccttggcgga
gcctgcttgcaggcctgccggggagtgcagacagctgccgccacagctcctcgaatcaag
aaatttgccatctaccgatgggacccagacaagactggagataaacctcgtatgcagact
tatgaaattgatttgaataaatgtggtcctatggtgttggatgctttaatcaagattaag
aatgaaattgattctaccttgaccttccgaagatcatgcagagaaggtatctgcggctct
tgtgccatgaacatcaacggaggtaacactctggcttgcacccgaaggatcgacaccaac
ctcaacaaagtctccaaaatctaccctcttccgcatatgtatgtgataaaggatctcgtt
cccgacttgagcaacttctacgctcagtacaaatccattgaaccttatttgaagaagaag
gatgaatcccaggagggcaagcagcagtatctgcagtccatagaagaccgtgagaaactg
gacgggctgtacgagtgtatcctctgtgcctgctgcagcaccagctgcccgagctactgg
tggaacggagacaaatacctggggcctgccgttcttatgcaggcgtaccgctggatgatc
gactcgagagatgacttcacggaggagcgcctggccaagctgcaggacccgttctccctg
taccgctgccacaccatcatgaactgcaccaggacctgccccaaggggctgaatccaggc
aaagctattgctgaaatcaagaaaatgatggccacctacacggggaagaaagcgtccgtg
taa

DBGET integrated database retrieval system