KEGG   Ursus maritimus (polar bear): 103666628
Entry
103666628         CDS       T03271                                 

Gene name
CASP9
Definition
(RefSeq) caspase 9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01524  Platinum drug resistance
umr04115  p53 signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04210  Apoptosis
umr04215  Apoptosis - multiple species
umr04370  VEGF signaling pathway
umr04919  Thyroid hormone signaling pathway
umr05010  Alzheimer disease
umr05012  Parkinson disease
umr05014  Amyotrophic lateral sclerosis
umr05016  Huntington disease
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05134  Legionellosis
umr05145  Toxoplasmosis
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05215  Prostate cancer
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    103666628 (CASP9)
   04151 PI3K-Akt signaling pathway
    103666628 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103666628 (CASP9)
   04215 Apoptosis - multiple species
    103666628 (CASP9)
   04115 p53 signaling pathway
    103666628 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103666628 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103666628 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103666628 (CASP9)
   05212 Pancreatic cancer
    103666628 (CASP9)
   05215 Prostate cancer
    103666628 (CASP9)
   05213 Endometrial cancer
    103666628 (CASP9)
   05222 Small cell lung cancer
    103666628 (CASP9)
   05223 Non-small cell lung cancer
    103666628 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103666628 (CASP9)
   05012 Parkinson disease
    103666628 (CASP9)
   05014 Amyotrophic lateral sclerosis
    103666628 (CASP9)
   05016 Huntington disease
    103666628 (CASP9)
   05020 Prion disease
    103666628 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    103666628 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103666628 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    103666628 (CASP9)
   05152 Tuberculosis
    103666628 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103666628 (CASP9)
   05161 Hepatitis B
    103666628 (CASP9)
   05160 Hepatitis C
    103666628 (CASP9)
   05164 Influenza A
    103666628 (CASP9)
   05162 Measles
    103666628 (CASP9)
   05168 Herpes simplex virus 1 infection
    103666628 (CASP9)
   05163 Human cytomegalovirus infection
    103666628 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103666628 (CASP9)
   05169 Epstein-Barr virus infection
    103666628 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103666628 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103666628 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:umr01009]
    103666628 (CASP9)
   01002 Peptidases and inhibitors [BR:umr01002]
    103666628 (CASP9)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     103666628 (CASP9)
Protein phosphatases and associated proteins [BR:umr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103666628 (CASP9)
Peptidases and inhibitors [BR:umr01002]
 Cysteine peptidases
  Family C14: caspase family
   103666628 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD
Other DBs
NCBI-GeneID: 103666628
NCBI-ProteinID: XP_008692916
UniProt: A0A384CDJ2
LinkDB
Position
Un
AA seq 413 aa
MIEDIQHAGSGSRNDQARQLVIDLETRGSQALPLFISCLEDTDQDKLASLLRMSRQAEKQ
NPEAVRPLNLMPVVLGPTGLTPEDLREKHGPSKPTPGKLAPVVLGPEQLWPDKLRPQVLR
SEVSRPVDSGSGRFSDVCAQEISKQNVDLAYALNTDPCGHCLIINNVNFCLESRLTTRAG
SNIDCEKLRRRFRLLHFTVEVKCDLTAKQMLQALVELARRDHGALDCCVVVVLSHGCQAS
HRQFPGAVYGTDGCPVSVEKIVNIFNGAGCPSLGGKPKLFFIQACGGEQKDHGFQVASAS
PEDRTPDSDPESDAVPFQEGPGPFDQPDAVSSLPTPSDIFVSYSTFPGFVSWRDTKSGSW
YVETLDGVFEQWADSEDLQTLLLRVANAVSQKGIYKQIPGCFNFLRKKLFFKT
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgatcgaggacattcagcatgcaggctcagggtctcggaacgatcaggccaggcagctg
gtcatagatctagagacccgagggagtcaggccctccctttgttcatctcctgcttagag
gacacagaccaggataagctggcttcattgctgagaatgagtcggcaagcagaaaagcag
aatccagaggctgtcagacccctgaacctcatgcctgtggtgcttggaccaacgggcctc
acaccagaggatctcagagagaagcacggtccatcaaagccgactccaggaaaactcgct
ccagtggtgctggggcctgagcagctctggccagacaagctcaggccacaggttctcaga
tcagaggtgtccaggccagtggacagtggttctggacgattcagtgatgtctgtgctcag
gagatttccaagcaaaatgttgatttggcgtacgccctgaacacagacccctgcggccac
tgcctcatcatcaacaacgtgaacttctgcctcgagtcgaggctcacgacccgcgccggc
tccaatatcgactgtgagaagctgcgtcggcgcttccgcttgctgcatttcacggtggag
gtgaagtgcgacctgacggccaagcaaatgctccaggctttggtggagctggcgcggcgc
gaccacggtgccctggactgctgcgtggtggtcgtcctctctcacggctgtcaggccagc
caccgccagttcccaggggctgtttatggcacggatggatgtcctgtgtctgtcgagaaa
attgtgaacatcttcaatggagccggctgccccagcttgggagggaagcccaagctcttc
ttcatccaggcctgtggtggggagcagaaagaccatggatttcaggtggcctctgcttcc
cccgaagacaggacccctgacagtgaccccgagtccgacgctgtcccgttccaggaaggc
ccaggcccctttgaccagccggacgccgtgtctagtttgcccacacccagtgacatcttt
gtgtcctactccaccttcccaggctttgtttcctggagggataccaagagcggctcctgg
tacgtggagaccttggacggtgtttttgagcagtgggctgactctgaggacctgcagacc
ctcctgctcagggtcgctaatgccgtttcgcagaaagggatttacaaacagattcccggt
tgtttcaatttcctccggaaaaaacttttttttaaaacgtaa

DBGET integrated database retrieval system