KEGG   Ursus maritimus (polar bear): 103666660
Entry
103666660         CDS       T03271                                 

Gene name
MTOR
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr04012  ErbB signaling pathway
umr04066  HIF-1 signaling pathway
umr04072  Phospholipase D signaling pathway
umr04136  Autophagy - other
umr04140  Autophagy - animal
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04218  Cellular senescence
umr04371  Apelin signaling pathway
umr04613  Neutrophil extracellular trap formation
umr04630  JAK-STAT signaling pathway
umr04659  Th17 cell differentiation
umr04714  Thermogenesis
umr04910  Insulin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr04920  Adipocytokine signaling pathway
umr04930  Type II diabetes mellitus
umr04931  Insulin resistance
umr04935  Growth hormone synthesis, secretion and action
umr05010  Alzheimer disease
umr05014  Amyotrophic lateral sclerosis
umr05016  Huntington disease
umr05017  Spinocerebellar ataxia
umr05022  Pathways of neurodegeneration - multiple diseases
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05221  Acute myeloid leukemia
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05230  Central carbon metabolism in cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103666660 (MTOR)
   04371 Apelin signaling pathway
    103666660 (MTOR)
   04630 JAK-STAT signaling pathway
    103666660 (MTOR)
   04066 HIF-1 signaling pathway
    103666660 (MTOR)
   04072 Phospholipase D signaling pathway
    103666660 (MTOR)
   04151 PI3K-Akt signaling pathway
    103666660 (MTOR)
   04152 AMPK signaling pathway
    103666660 (MTOR)
   04150 mTOR signaling pathway
    103666660 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103666660 (MTOR)
   04136 Autophagy - other
    103666660 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    103666660 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103666660 (MTOR)
   04659 Th17 cell differentiation
    103666660 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103666660 (MTOR)
   04920 Adipocytokine signaling pathway
    103666660 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    103666660 (MTOR)
   04919 Thyroid hormone signaling pathway
    103666660 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    103666660 (MTOR)
   04213 Longevity regulating pathway - multiple species
    103666660 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    103666660 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103666660 (MTOR)
   05206 MicroRNAs in cancer
    103666660 (MTOR)
   05205 Proteoglycans in cancer
    103666660 (MTOR)
   05230 Central carbon metabolism in cancer
    103666660 (MTOR)
   05231 Choline metabolism in cancer
    103666660 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103666660 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103666660 (MTOR)
   05212 Pancreatic cancer
    103666660 (MTOR)
   05225 Hepatocellular carcinoma
    103666660 (MTOR)
   05226 Gastric cancer
    103666660 (MTOR)
   05214 Glioma
    103666660 (MTOR)
   05221 Acute myeloid leukemia
    103666660 (MTOR)
   05215 Prostate cancer
    103666660 (MTOR)
   05224 Breast cancer
    103666660 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103666660 (MTOR)
   05014 Amyotrophic lateral sclerosis
    103666660 (MTOR)
   05016 Huntington disease
    103666660 (MTOR)
   05017 Spinocerebellar ataxia
    103666660 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    103666660 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103666660 (MTOR)
   04931 Insulin resistance
    103666660 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103666660 (MTOR)
   05168 Herpes simplex virus 1 infection
    103666660 (MTOR)
   05163 Human cytomegalovirus infection
    103666660 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103666660 (MTOR)
   05165 Human papillomavirus infection
    103666660 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103666660 (MTOR)
   01522 Endocrine resistance
    103666660 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103666660 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103666660 (MTOR)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103666660 (MTOR)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   103666660 (MTOR)
Membrane trafficking [BR:umr04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    103666660 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 V-ATPase_H_N UME EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 103666660
NCBI-ProteinID: XP_008692956
UniProt: A0A384CDN2
LinkDB
Position
Un
AA seq 2543 aa
MLGTGPAAATAATTTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPPQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTALPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRXLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMID
QSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSHH
HTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVKSHI
RPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNS
PGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVDRLTESLD
FTDYASRIIHPIVRTLDQSPELRPTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQ
RYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHVSTINLQK
AWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWS
ELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERA
AKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQA
TWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTLVNDE
TQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKA
RDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWWERLQGCQ
RIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDH
PLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTVQQQAQHAIATEDQQHKQELHKLM
ARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEAVLHYKHQ
NQARDEKKKLRHASGANITSTTTAATTAATATATATSTEGSNSESEAESTENSPTPSPLQ
KKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEG
VKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTA
RHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKG
MFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYH
VFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSK
QRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYA
VIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEV
FEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLML
DRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEV
LREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEP
AHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETLDVPTQVE
LLIKQATSHENLCQCYIGWCPFW
NT seq 7632 nt   +upstreamnt  +downstreamnt
atgctgggaactggacccgctgccgccaccgcagctaccaccacgtccagcaacgtgagc
gtcctgcagcagttcgccagtggcctgaagagccggaatgaggagaccagggccaaagct
gccaaggagctccagcactatgtcaccatggagcttcgagagatgagtcaagaggagtct
actcgattctatgatcagctgaaccatcacatttttgaactggtttccagctcagatgcc
aatgagaggaaaggtggcatcttggccatagccagcctcataggagtggaaggcgggaat
gccactcggattggcagattcgctaactatcttcggaacctcctcccctcgaatgaccca
gttgtcatggagatggcatccaaggccattggccgcctcgccatggcaggggacactttt
acggctgagtatgtggagtttgaggtgaagcgagccttggagtggctgggcgccgaccgc
aacgagggccggagacacgccgctgttctggttctccgtgagctggccatcagcgtcccc
accttcttcttccagcaagtgcagcccttctttgacaacatttttgtggccgtgtgggac
cccaaacaggccatccgtgagggagccgtggccgcccttcgtgcctgcctgattctcacc
actcagcgtgagccgaaggagatgcagaagcctcagtggtaccggcatacgtttgaagaa
gcagagaaagggtttgatgagacgttggccaaggagaaaggcatgaatcgggatgatcgc
atccatggagccttgctgatcctcaacgagttggtccgaatcagcagcatggagggagag
cgcctgagagaagaaatggaagaaatcacacagcagcagctcgtgcatgacaagtactgc
aaggacctcatgggctttgggacgaaacctcgccacattacccccttcaccagtttccag
gccgtccagcccccgcagtccaatgccttggtgggactgctggggtacagctctcaccaa
ggcctcatggggttcggggcttcccccagcccagcgaagtccaccctggtggagagtcgg
tgttgcagagacctgatggaggagaaatttgatcaagtgtgccagtgggtgctgaaatgc
aggaacagcaagaactcgctgatccagatgacaatccttaatctgttgccccgcctggcc
gcgtttcgaccttccgccttcacagatacccagtacctccaagataccatgaaccatgtc
ttaagctgtgtcaagaaggagaaggaacgtacagcagccttccaagccctggggctgctt
tctgtggctgtgagatctgaatttaaggtctatttacctcgtgtgctggacatcatccgt
gcagccctaccccctaaggactttgcccataagagacagaaggccatgcaggtggatgcc
acagtgttcacctgcatcagcatgctggcccgggcaatggggccaggcatccaacaggat
atcaaggagctgctggagcccatgctggcagtgggactgagccctgccctcactgctgtg
ctgtacgacctgagccgtcagattccgcagctgaagaaggacatccaggatgggctcctg
aagatgctgtccctggtcctgatgcacaaacccctccggcatccgggcatgcccaagggc
ctggcccatcagctagcttcccctggcctcacagccctgcctgaggccagcgatgtcggc
agcattactcttgccctgcgaacacttggcagctttgaatttgaaggccactctctgacc
cagttcgtccgccactgtgcggatcatttcctaaacagcgagcacaaggagatccgcatg
gaagctgcccgcacctgctcccgcctgctcacgccctctgtccacctcatcagtggccac
gctcacgtggttagccagactgcagtacaagtggtggcagacgtgctcagcaagctgctc
gtggttgggataacagatcctgaccctgacatccgctactgtgtcttggcatccctggat
gagcgctttgatgcacacctggcccaggcagagaatttgcaggccctgtttgtggccctg
aacgaccaggtgtttgagatccgggagctggccatctgcaccgtgggccggctcagtagc
atgaacccagccttcgtcatgcctttcctgcgcaagatgcttatccagattttgacggag
ctggagcacagcggcattggaagaatcaaagagcaaagtgcccgcatgctgggacacctc
gtctccaatgcaccccggctcatccgcccctacatggagcccattctgaaggctttaatt
ttgaaactgaaagatccggaccctgatccaaacccaggtgtgatcaataatgtcttagct
acaataggagaattggctcaggttagtggcctagaaatgaggaagtgggtggatgaactc
tttattatcatcatggacatgctccaggactcctcgctgttggccaaaaggcaggtggct
ctgtggaccctgggacagttggtggccagcactggctatgtagtggagccctacaggnnc
ctgctgaattttctgaagactgagcagaaccagggtacacggagagaggctatccgtgtg
ttggggcttttgggggccctggatccctacaagcacaaagtaaacattggcatgattgac
cagtcccgcgacgcttctgctgtcagcctatctgaatccaagtcaagtcaggattcctcg
gactacagcaccagcgagatgctggtcaacatgggcaacctgcccctggatgagttctac
cctgctgtgtccatggtggcgctgatgcggatcttccgagaccagtccctctcgcaccat
cacaccatggttgtccaggccatcaccttcatcttcaagtctctgggcctcaagtgtgtg
cagttcctgccgcaggtcatgcccacattcctcaatgtcattcgggtctgcgatggggcc
atccgggaattcctgttccagcagctgggaatgctggtgtcctttgtgaagagccacatc
cgaccttacatggatgaaatagtcaccctcatgagagaattctgggtcatgaacacctcg
atccagagcacaatcatccttctcattgagcaaatagtggtagctcttgggggtgaattt
aagctctacctgccccagctgatcccacacatgctacgcgtcttcatgcatgacaacagc
ccaggccgcatcgtctccatcaagctgttggccgccatccagctgtttggcgccaacctg
gatgactatctgcatttgttgttgccccctatcgtgaagctgtttgacgccccggaagtc
cccctgccatctcggaaggcagcattagagacagtggaccgcctgacagagtccctggac
ttcactgactacgcctcccggatcattcatccgattgttcgaacgctggaccagagcccg
gaactgcgtcccacggccatggacacgttgtcttcgctggtcttccaactggggaagaag
taccaaattttcattccaatggtgaataaagtcctggtgcgacaccgaatcaaccatcag
cgctacgacgtcctcatctgcagaatcgtcaagggatacacccttgctgatgaagaagag
gaccctttgatttaccagcatcgaatgctgaggagtggccagggggatgcattggctagt
gggccagtagaaacagggcccatgaagaaactgcatgtcagcaccatcaacctccaaaag
gcctggggagctgccagaagggtctccaaagatgactggctggaatggctgaggcggctg
agtctggagctcctgaaggactcctcgtcgccttccctgcgctcgtgctgggccctggct
caggcctacaacccaatggccagggatctttttaatgccgcatttgtgtcctgctggtct
gaactgaatgaagaccagcaggatgaactcatcagaagcatcgagttggccctcacctcg
caggacatcgctgaagtcacgcagaccctcttaaacttggctgaattcatggaacacagt
gacaagggccctctgccattgagagacgacaatggcatcgtcctgctgggtgagagggct
gccaagtgccgagcatatgccaaagcactccactacaaagaactggagttccagaaaggt
cccacccctgccatcctagagtctctcatcagcattaataataagctccagcagccggag
gcagccgcgggggtgttagagtatgccatgaaacacttcggagagctggagatccaggct
acctggtacgagaaactgcacgagtgggaggacgcgctcgtggcctacgacaagaagatg
gacaccaacaaggatgacccggagctgatgctgggccgcatgcgctgcctcgaggccctg
ggggaatggggccagctccaccagcagtgctgtgaaaagtggaccctggttaatgatgag
acccaagccaagatggcccgcatggctgccgcagctgcgtggggtttaggtcagtgggac
agcatggaggagtatacctgtatgatccctcgggacacccacgatggggcattttacaga
gccgtgctggcactgcatcaggacctcttctccttggcgcaacagtgcatcgacaaagcc
agagacctgctggatgccgagttaaccgctatggcaggagagagctacagtcgggcatat
ggggccatggtctcttgccacatgctctccgagctggaggaggttatccagtacaaactt
gtccccgagcgacgggagatcatccgccagatctggtgggagaggctgcagggctgccag
cgtattgtggaggactggcagaaaatcctgatggtgcggtcgctcgtggtcagccctcat
gaggatatgaggacctggctcaagtatgccagcctgtgcgggaagagtggcaggctggcc
cttgctcataaaaccttagtgttgctcctgggagttgatccatctcggcaacttgaccac
cctctgccaacagttcaccctcaggtgacctacgcctacatgaaaaacatgtggaagagc
gctcgcaagatcgacgccttccagcacatgcagcacttcgtgcagaccgtgcagcagcag
gcccagcacgccatcgccaccgaggaccagcagcacaagcaagagctgcacaagctcatg
gcccggtgcttcctgaagctcggggagtggcagctgaacctgcagggcatcaacgagagc
accatccccaaagtgctgcagtactacagcgcggccacggagcacgaccgcagctggtac
aaggcctggcacgcgtgggcagtgatgaactttgaggctgtgctgcactacaaacatcag
aaccaagcccgggacgagaagaagaagctgcggcacgccagcggggccaacatcaccagc
acgaccactgccgccaccacagcggccaccgccaccgccaccgccaccagcaccgagggc
agcaacagcgagagtgaggccgagagcaccgagaacagccccaccccatctcctctgcag
aagaaggtcactgaggatttatccaaaaccctcttgatgtacaccgtccctgcggtccag
ggcttcttccgttccatctccttgtcacgaggcaacaacctccaggacacgctgagagtc
ctcaccttatggtttgactatggtcactggccagacgtaaatgaagccttagtggagggg
gtgaaagcaattcagattgacacttggttacaggttataccgcagctcatcgcaaggatc
gatactcctaggcccttggtgggccgcctcattcaccagcttctcactgacattggccgg
taccacccgcaggccctcatctaccccctgaccgtggcctctaagtccaccacaacggcc
cgccacaacgcagccaacaagattctgaagaacatgtgcgagcacagtaacaccctggtc
cagcaggccatgatggtgagtgaggagctaatccgcgtggccatcctctggcacgagatg
tggcacgaaggcctggaagaagcgtctcgtttgtactttggggaaaggaacgtgaaaggc
atgtttgaggtgctggagcccctgcatgctatgatggaacggggcccccagactctgaag
gaaacatcttttaatcaggcatatggtcgagacttaatggaggcccaagagtggtgcagg
aagtacatgaaatccgggaacgtcaaggacctcacccaagcctgggacctctattatcac
gtgttcagacgaatctcgaagcagctgcctcagctcacctccttagaactgcagtatgtt
tcccccaaacttctgatgtgccgggaccttgaattggctgtgccagggacgtacgacccc
aaccagccgatcattcgcattcagtccatagcgccgtccctgcaggtcatcacctccaag
cagaggccccggaagctgacgctaatgggcagcaacgggcatgagtttgttttcctcctg
aagggccatgaagacctgcggcaggatgagcgagtgatgcagctctttggcctggtgaac
acccttctggccaacgacccaacgtctcttcgcaagaacctcagcatccagagatacgct
gtcatccccttatcaaccaactcgggcctcatcggctgggtcccccactgcgacacgctg
cacgccctcatccgggactacagagagaagaagaagatccttctcaacatcgagcatcgc
atcatgttgcggatggcaccggactacgatcacctgacgctgatgcagaaggtggaggtg
ttcgagcacgccgtcaataacacggccggcgacgacctggccaagctgctgtggctgaag
agccccagctccgaggtgtggtttgaccgaagaaccaactatacccgctctttagcggtc
atgtccatggttgggtatattttgggcctgggagatcgacacccatccaacctaatgctg
gaccggctgagtgggaagatcctgcacatcgactttggggactgctttgaggttgctatg
accagggagaaattcccagagaagattccatttagactaacaagaatgctgaccaatgct
atggaggttactggtctggatggcaactatagaatcacgtgccacacggtgatggaagtg
cttcgggaacacaaggatagtgtcatggccgtgctggaagcctttgtctatgaccccttg
ctgaactggaggctgatggacacaaataccaaaggcaacaagcggtcccgaacaaggacg
gattcctactctgctggccagtcagtagaaattttggacggtgtggaacttggggaacct
gcccataagaaaacggggaccacagtgccagaatctattcattctttcattggagacggt
ttggtgaaaccagaggccctaaataagaaagctattcaaattattaacagggttcgagac
aagctcactggtcgggacttttctcatgacgaaaccctggatgtcccaacacaggtggag
ctgctcatcaaacaagcaacgtcccacgagaacctctgtcaatgctacatcggctggtgt
cctttctggtaa

DBGET integrated database retrieval system