KEGG   Ursus maritimus (polar bear): 103667329
Entry
103667329         CDS       T03271                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase B1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr04012  ErbB signaling pathway
umr04066  HIF-1 signaling pathway
umr04140  Autophagy - animal
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04350  TGF-beta signaling pathway
umr04371  Apelin signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04714  Thermogenesis
umr04910  Insulin signaling pathway
umr04931  Insulin resistance
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05221  Acute myeloid leukemia
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103667329 (RPS6KB1)
   04350 TGF-beta signaling pathway
    103667329 (RPS6KB1)
   04371 Apelin signaling pathway
    103667329 (RPS6KB1)
   04066 HIF-1 signaling pathway
    103667329 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    103667329 (RPS6KB1)
   04152 AMPK signaling pathway
    103667329 (RPS6KB1)
   04150 mTOR signaling pathway
    103667329 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103667329 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    103667329 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103667329 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    103667329 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    103667329 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    103667329 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103667329 (RPS6KB1)
   05205 Proteoglycans in cancer
    103667329 (RPS6KB1)
   05231 Choline metabolism in cancer
    103667329 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103667329 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103667329 (RPS6KB1)
   05212 Pancreatic cancer
    103667329 (RPS6KB1)
   05225 Hepatocellular carcinoma
    103667329 (RPS6KB1)
   05226 Gastric cancer
    103667329 (RPS6KB1)
   05221 Acute myeloid leukemia
    103667329 (RPS6KB1)
   05224 Breast cancer
    103667329 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103667329 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103667329 (RPS6KB1)
   05163 Human cytomegalovirus infection
    103667329 (RPS6KB1)
   05165 Human papillomavirus infection
    103667329 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103667329 (RPS6KB1)
   01522 Endocrine resistance
    103667329 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103667329 (RPS6KB1)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103667329 (RPS6KB1)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   103667329 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 103667329
NCBI-ProteinID: XP_008693685
UniProt: A0A384CGY7
LinkDB
Position
Un
AA seq 525 aa
MRRRRRRDGFYPVPDFQDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
VEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacccagtgccggacttccaagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatttcggaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcattgtggatttaatttat
gcctttcagaccggtggaaaactctacctcatccttgagtatctcagcggaggagaatta
tttatgcagttagaaagagagggaatatttatggaagacacagcctgcttttacttggca
gaaatctccatggctttggggcatttgcatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccgttcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcggcttggagctggtcct
ggggatgctggagaagttcaggctcatccattcttcaggcatattaactgggaagaactg
ctggctcggaaggtggagcccccctttaaacctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtctttctgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaaattttcctttgaaccaaaaatccgatcacctcgaagatttattggc
agcccacgaacacctgtcagcccggtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacggcaaatcctcagacacctgtggaatatcccatggaaacaagtgga
gtagagcagatggatgtgacgatgagtggggaagcttcagcaccacttccaatacgacag
ccgaactccgggccatacaaaaaacaagcttttcccatgatctccaaacgaccagagcac
ctacgtatgaatctatga

KEGG   Ursus maritimus (polar bear): 103679516
Entry
103679516         CDS       T03271                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase B2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr04012  ErbB signaling pathway
umr04066  HIF-1 signaling pathway
umr04140  Autophagy - animal
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04350  TGF-beta signaling pathway
umr04371  Apelin signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04714  Thermogenesis
umr04910  Insulin signaling pathway
umr04931  Insulin resistance
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05221  Acute myeloid leukemia
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103679516 (RPS6KB2)
   04350 TGF-beta signaling pathway
    103679516 (RPS6KB2)
   04371 Apelin signaling pathway
    103679516 (RPS6KB2)
   04066 HIF-1 signaling pathway
    103679516 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    103679516 (RPS6KB2)
   04152 AMPK signaling pathway
    103679516 (RPS6KB2)
   04150 mTOR signaling pathway
    103679516 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103679516 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    103679516 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103679516 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    103679516 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    103679516 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    103679516 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103679516 (RPS6KB2)
   05205 Proteoglycans in cancer
    103679516 (RPS6KB2)
   05231 Choline metabolism in cancer
    103679516 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103679516 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103679516 (RPS6KB2)
   05212 Pancreatic cancer
    103679516 (RPS6KB2)
   05225 Hepatocellular carcinoma
    103679516 (RPS6KB2)
   05226 Gastric cancer
    103679516 (RPS6KB2)
   05221 Acute myeloid leukemia
    103679516 (RPS6KB2)
   05224 Breast cancer
    103679516 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103679516 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103679516 (RPS6KB2)
   05163 Human cytomegalovirus infection
    103679516 (RPS6KB2)
   05165 Human papillomavirus infection
    103679516 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103679516 (RPS6KB2)
   01522 Endocrine resistance
    103679516 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103679516 (RPS6KB2)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103679516 (RPS6KB2)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   103679516 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 103679516
NCBI-ProteinID: XP_008707300
UniProt: A0A384DKI2
LinkDB
Position
Un
AA seq 447 aa
MELTETSVNQGPERIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIV
RNAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFL
EDTACFYLAEITLALGHLHSQGIIYRDLKPENIMLSGQGHIKLTDFGLCKESIHEGAVTH
TFCGTIEYMAPEILVRSGHNRGGPHPGAGARPGPGGRPPSLTLCLLQPPFTAENRKKTMD
KIIKGKLILPPYLTPDARDLVKKFLKRNPSQRIGGGPGDAADVQRHPFFRHINWDDLLAR
RVDPPFRPSLQSEEDVSQFDTHFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIK
EGFSFQPKLRSPRRLNSSPRTPVSPLKFLPFEGFRPSSGPLEPKEPPLPPLLPPPPPPPP
PSRTAPLPIRPPSGTKKSKRGRGRPGR
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggagctcactgagaccagtgtgaaccagggccccgagcgcatcgggccccactgcttt
gagctgctgcgtgtgctgggcaaggggggctatggcaaggtgttccaagtgcgaaaggtg
cagggcaccaacttgggcaaaatatatgccatgaaagtcctgaggaaggccaaaattgtg
cgcaacgccaaggacacagcacacacgcgggctgaacggaacattctagagtcagtgaag
caccccttcattgtggaactggcctatgccttccagactggtggcaaactctacctcatc
ctcgagtgcctcagtggcggtgagctcttcacgcatctggagcgagagggcatcttcctg
gaagacacggcctgtttctacctggcggagatcacgctggccctgggccatctccactcc
caaggcatcatctaccgggacctcaaacctgagaacatcatgctcagcggccagggccac
atcaaactgacagactttggtctgtgcaaggagtcgatccacgagggtgctgtcacccac
actttctgtggcaccattgagtacatggcccctgagattctggtacgcagcggccacaac
cgggggggtccccatcctggggcaggggcaaggccagggcctggggggaggcccccaagt
ctcaccctctgccttctccagccacccttcactgcggagaaccggaagaaaaccatggac
aagatcatcaaagggaagctgattctgcccccctacctcacccctgatgcccgggacctt
gtcaaaaagtttctgaagcggaatcccagccaacggatcgggggtggccccggggatgct
gctgatgtgcagaggcaccccttcttccggcatattaattgggatgacctcctggctcgc
cgcgtagacccccctttcaggccctctctgcagtcagaggaggatgtgagccagtttgac
acccacttcacgcggcagacgccggtggacagtccagatgatacggccctcagtgagagc
gcaaaccaggccttcctgggcttcacgtacgtggcaccctccgtcctggacagcatcaag
gagggcttctccttccagcccaagctgcgctcccccaggcgcctcaacagcagcccccgg
accccggtcagccccctgaagttcttgccctttgagggattccggcccagctctggccca
ctggagcccaaggagccccctctacctcctctcctgccgccgccaccgccaccgccacca
ccgtcacgcactgccccactccccatccgacccccctcagggaccaagaagtctaagagg
ggccgtgggcgcccaggccgctag

DBGET integrated database retrieval system