KEGG   Ursus maritimus (polar bear): 103667825
Entry
103667825         CDS       T03271                                 

Gene name
PPP3CB
Definition
(RefSeq) protein phosphatase 3 catalytic subunit beta
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04114  Oocyte meiosis
umr04218  Cellular senescence
umr04310  Wnt signaling pathway
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04380  Osteoclast differentiation
umr04625  C-type lectin receptor signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04720  Long-term potentiation
umr04724  Glutamatergic synapse
umr04728  Dopaminergic synapse
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04924  Renin secretion
umr05010  Alzheimer disease
umr05014  Amyotrophic lateral sclerosis
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05031  Amphetamine addiction
umr05152  Tuberculosis
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103667825 (PPP3CB)
   04310 Wnt signaling pathway
    103667825 (PPP3CB)
   04370 VEGF signaling pathway
    103667825 (PPP3CB)
   04020 Calcium signaling pathway
    103667825 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    103667825 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103667825 (PPP3CB)
   04218 Cellular senescence
    103667825 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103667825 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    103667825 (PPP3CB)
   04660 T cell receptor signaling pathway
    103667825 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    103667825 (PPP3CB)
   04659 Th17 cell differentiation
    103667825 (PPP3CB)
   04662 B cell receptor signaling pathway
    103667825 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103667825 (PPP3CB)
   04921 Oxytocin signaling pathway
    103667825 (PPP3CB)
   04924 Renin secretion
    103667825 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    103667825 (PPP3CB)
   04728 Dopaminergic synapse
    103667825 (PPP3CB)
   04720 Long-term potentiation
    103667825 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    103667825 (PPP3CB)
   04380 Osteoclast differentiation
    103667825 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103667825 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103667825 (PPP3CB)
   05014 Amyotrophic lateral sclerosis
    103667825 (PPP3CB)
   05020 Prion disease
    103667825 (PPP3CB)
   05022 Pathways of neurodegeneration - multiple diseases
    103667825 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    103667825 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103667825 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103667825 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    103667825 (PPP3CB)
   05163 Human cytomegalovirus infection
    103667825 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103667825 (PPP3CB)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     103667825 (PPP3CB)
Protein phosphatases and associated proteins [BR:umr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     103667825 (PPP3CB)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 103667825
NCBI-ProteinID: XP_008694267
UniProt: A0A384CHJ1
LinkDB
Position
Un
AA seq 481 aa
MDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFF
DLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHL
TEXXXXXXXECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRL
DRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLL
SIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFN
CSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKE
IIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEA
EKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHSA
Q
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggatgggatacccagggttgatgttctgaagaaccacttagtaaaagaaggtcgggta
gatgaagaaattgcacttagaattatcaatgaaggtgctgccatccttcggagagagaaa
accatgatagaagtagaggctccaattacagtgtgtggtgacatccatggccaatttttt
gatctgatgaaactttttgaagtaggaggatcacctgctaatacacgatacctttttctt
ggtgattatgtggacagaggttattttagtatagagtgtgtcttatatttatgggtcctg
aagattctgtacccaagcacattatttcttctgagaggcaatcatgaatgcagacacctt
actgaatannnnnnnnnnnnnnnnnnngaatgtaaaattaaatattcagaaagagtctat
gaagcttgtatggaagcttttgatagtctgcctcttgctgcacttttaaatcaacaattt
ctttgtgttcatggtggactttcaccagaaatacacacactggatgatattaggagatta
gatagattcaaagagccacctgcatttggaccaatgtgtgacttgctatggtccgatcct
tctgaagattttggaaatgaaaaatcacaggaacattttagtcacaatacagttcgagga
tgttcttatttttataactatccagcagtgtgtgaatttttgcaaaacaataatttgtta
tcgattattagagctcatgaagctcaagatgcaggctatagaatgtacagaaaaagtcaa
actacagggttcccttcattaataacaattttttcggcacctaattacttagatgtctac
aataataaagctgctgtattaaagtatgaaaataatgtgatgaatattcgacagtttaac
tgttctccacatccttactggttgcccaattttatggatgtcttcacatggtctttacca
tttgttggagaaaaagtgacagaaatgttggtaaatgttctgagtatttgctctgatgat
gaactgatgactgaaggtgaagaccagtttgatgtaggttcagctgcagcccggaaagaa
atcataagaaacaaaattcgagcaattggcaagatggcacgggtcttctctgttctcagg
gaggagagtgaaagcgtgctgacactcaagggcctgactcccacagggatgttgcctagt
ggagtgttggctggaggacggcagaccctgcaaagtgccacagttgaggctattgaggct
gaaaaagcaatacgaggattctctccaccacatagaatctgcagttttgaagaggcaaag
ggtttggataggatcaatgagagaatgccaccccggaaagatgctgtacagcaagatggt
ttcaattctctgaacaccgcacatgccactgagaaccacgggactggcaaccatagtgcc
cagtga

KEGG   Ursus maritimus (polar bear): 103671340
Entry
103671340         CDS       T03271                                 

Gene name
PPP3R1
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, alpha
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04114  Oocyte meiosis
umr04218  Cellular senescence
umr04310  Wnt signaling pathway
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04380  Osteoclast differentiation
umr04625  C-type lectin receptor signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04720  Long-term potentiation
umr04724  Glutamatergic synapse
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04924  Renin secretion
umr05010  Alzheimer disease
umr05014  Amyotrophic lateral sclerosis
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05031  Amphetamine addiction
umr05152  Tuberculosis
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103671340 (PPP3R1)
   04310 Wnt signaling pathway
    103671340 (PPP3R1)
   04370 VEGF signaling pathway
    103671340 (PPP3R1)
   04020 Calcium signaling pathway
    103671340 (PPP3R1)
   04022 cGMP-PKG signaling pathway
    103671340 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103671340 (PPP3R1)
   04218 Cellular senescence
    103671340 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103671340 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    103671340 (PPP3R1)
   04660 T cell receptor signaling pathway
    103671340 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    103671340 (PPP3R1)
   04659 Th17 cell differentiation
    103671340 (PPP3R1)
   04662 B cell receptor signaling pathway
    103671340 (PPP3R1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103671340 (PPP3R1)
   04921 Oxytocin signaling pathway
    103671340 (PPP3R1)
   04924 Renin secretion
    103671340 (PPP3R1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103671340 (PPP3R1)
   04720 Long-term potentiation
    103671340 (PPP3R1)
  09158 Development and regeneration
   04360 Axon guidance
    103671340 (PPP3R1)
   04380 Osteoclast differentiation
    103671340 (PPP3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103671340 (PPP3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103671340 (PPP3R1)
   05014 Amyotrophic lateral sclerosis
    103671340 (PPP3R1)
   05020 Prion disease
    103671340 (PPP3R1)
   05022 Pathways of neurodegeneration - multiple diseases
    103671340 (PPP3R1)
  09165 Substance dependence
   05031 Amphetamine addiction
    103671340 (PPP3R1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103671340 (PPP3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103671340 (PPP3R1)
   05170 Human immunodeficiency virus 1 infection
    103671340 (PPP3R1)
   05163 Human cytomegalovirus infection
    103671340 (PPP3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103671340 (PPP3R1)
Protein phosphatases and associated proteins [BR:umr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     103671340 (PPP3R1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 103671340
NCBI-ProteinID: XP_008698161
UniProt: A0A384CTL9
LinkDB
Position
Un
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgctgatgaaatt
aaaaggctaggaaagagatttaagaagctcgacttggacaattcgggatctttgagtgtg
gaagagttcatgtctctgcctgagttacaacagaatcctttagtacagcgagtaatagat
atatttgacacagatgggaatggagaagtagactttaaagaattcattgagggagtctct
cagttcagtgtcaaaggagataaggaacagaagttgaggtttgctttccgtatctatgac
atggataaagatggctatatttccaatggggaactcttccaggtgctgaagatgatggtg
gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca
gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtagatgtgtga

KEGG   Ursus maritimus (polar bear): 103673318
Entry
103673318         CDS       T03271                                 

Gene name
PPP3CC
Definition
(RefSeq) protein phosphatase 3 catalytic subunit gamma
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04114  Oocyte meiosis
umr04218  Cellular senescence
umr04310  Wnt signaling pathway
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04380  Osteoclast differentiation
umr04625  C-type lectin receptor signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04720  Long-term potentiation
umr04724  Glutamatergic synapse
umr04728  Dopaminergic synapse
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04924  Renin secretion
umr05010  Alzheimer disease
umr05014  Amyotrophic lateral sclerosis
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05031  Amphetamine addiction
umr05152  Tuberculosis
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103673318 (PPP3CC)
   04310 Wnt signaling pathway
    103673318 (PPP3CC)
   04370 VEGF signaling pathway
    103673318 (PPP3CC)
   04020 Calcium signaling pathway
    103673318 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    103673318 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103673318 (PPP3CC)
   04218 Cellular senescence
    103673318 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103673318 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    103673318 (PPP3CC)
   04660 T cell receptor signaling pathway
    103673318 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    103673318 (PPP3CC)
   04659 Th17 cell differentiation
    103673318 (PPP3CC)
   04662 B cell receptor signaling pathway
    103673318 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103673318 (PPP3CC)
   04921 Oxytocin signaling pathway
    103673318 (PPP3CC)
   04924 Renin secretion
    103673318 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    103673318 (PPP3CC)
   04728 Dopaminergic synapse
    103673318 (PPP3CC)
   04720 Long-term potentiation
    103673318 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    103673318 (PPP3CC)
   04380 Osteoclast differentiation
    103673318 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103673318 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103673318 (PPP3CC)
   05014 Amyotrophic lateral sclerosis
    103673318 (PPP3CC)
   05020 Prion disease
    103673318 (PPP3CC)
   05022 Pathways of neurodegeneration - multiple diseases
    103673318 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    103673318 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103673318 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103673318 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    103673318 (PPP3CC)
   05163 Human cytomegalovirus infection
    103673318 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103673318 (PPP3CC)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     103673318 (PPP3CC)
Protein phosphatases and associated proteins [BR:umr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     103673318 (PPP3CC)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 103673318
NCBI-ProteinID: XP_008700302
UniProt: A0A384CZQ2
LinkDB
Position
Un
AA seq 452 aa
MIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGYFSIECVLFLWSLK
INHPKTVFLLRGNHECRHLTEYFTFKQECRIKYSEQVYDACMETFDCLPLAALLNQQFLC
VHGGMSPEITSLDDIKKLDRFKEPPAFGPVCDLLWSDPSEDYGNEKTLEHYTHNTVRGCS
YFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNN
KAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNILNICSDDEL
ISDDEIEGGTTVRKEIIKNKIRAIGKMARVFSILREESESVLTLKGLTPTGTLPLGVLSG
GKQTIETATVEAVEAREAIRGFSLQHRIRSFEEARGLDRINERMPPRKDSQYPDGPVKLV
APPQPNAAHRNDRGRRASNDAEPCCGTGGSKT
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgatagaagtagatgctccaatcacagtgtgtggtgacattcatggacagttttttgac
ctgatgaagttgtttgaagttggaggatcacctagtaacacacgctacctctttctgggt
gactatgtggacagaggctatttcagtatagagtgtgtgctgtttttatggagtttaaag
attaatcatcccaaaacagtgtttctgcttcgaggaaatcatgaatgcaggcatcttaca
gaatacttcaccttcaaacaggaatgtcgaatcaaatattctgaacaggtgtatgatgcg
tgtatggagacatttgactgtcttcctcttgctgccctcttaaaccagcagtttctgtgt
gtacatggagggatgtcacctgaaattactagtttagatgacattaagaaattagaccgg
tttaaagaacctccagcctttgggccagtgtgtgacctgctttggtctgatccttcagag
gattatggcaatgaaaagaccttggagcactatacccacaacactgtccgagggtgctct
tatttttacagttaccctgcagtctgtgaatttttgcagaacaataatttgttatcaata
atcagagctcatgaagcccaggatgctgggtatcgaatgtacaggaagagccaaacaaca
ggctttccgtcactcattacaattttctctgcccccaattacctagatgtctataataat
aaagctgctgtgctaaaatacgaaaacaatgtcatgaatatcaggcagtttaactgttct
ccacacccctactggcttccgaactttatggacgttttcacatggtctttgccatttgtt
ggggaaaaagtcacagagatgctggttaacattctcaacatatgctctgatgatgaattg
atttccgatgatgaaattgaaggaggcactacagttcgaaaggaaatcatcaagaataag
atcagagccattgggaagatggcacgagtcttttcaattctgcgggaagagagtgagagt
gtgctgactctcaagggcctgactccaacagggacactccctctaggtgtcctctcagga
ggaaaacagaccattgagacagccacagtagaagcggtagaggcccgggaagccatcaga
gggttttcgcttcagcacaggatccggagttttgaagaagcccgaggtctggaccgaatt
aacgaacggatgccaccccgaaaagacagccagtaccccgatgggccagtgaaattggtt
gcccctccacaacccaacgctgcgcacaggaacgacagggggagaagagccagtaatgac
gcagagccctgctgtggcacaggtggatccaaaacttaa

KEGG   Ursus maritimus (polar bear): 103677943
Entry
103677943         CDS       T03271                                 

Gene name
PPP3CA
Definition
(RefSeq) protein phosphatase 3 catalytic subunit alpha
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04114  Oocyte meiosis
umr04218  Cellular senescence
umr04310  Wnt signaling pathway
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04380  Osteoclast differentiation
umr04625  C-type lectin receptor signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04720  Long-term potentiation
umr04724  Glutamatergic synapse
umr04728  Dopaminergic synapse
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04924  Renin secretion
umr05010  Alzheimer disease
umr05014  Amyotrophic lateral sclerosis
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05031  Amphetamine addiction
umr05152  Tuberculosis
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103677943 (PPP3CA)
   04310 Wnt signaling pathway
    103677943 (PPP3CA)
   04370 VEGF signaling pathway
    103677943 (PPP3CA)
   04020 Calcium signaling pathway
    103677943 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    103677943 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103677943 (PPP3CA)
   04218 Cellular senescence
    103677943 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103677943 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    103677943 (PPP3CA)
   04660 T cell receptor signaling pathway
    103677943 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    103677943 (PPP3CA)
   04659 Th17 cell differentiation
    103677943 (PPP3CA)
   04662 B cell receptor signaling pathway
    103677943 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103677943 (PPP3CA)
   04921 Oxytocin signaling pathway
    103677943 (PPP3CA)
   04924 Renin secretion
    103677943 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    103677943 (PPP3CA)
   04728 Dopaminergic synapse
    103677943 (PPP3CA)
   04720 Long-term potentiation
    103677943 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    103677943 (PPP3CA)
   04380 Osteoclast differentiation
    103677943 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103677943 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103677943 (PPP3CA)
   05014 Amyotrophic lateral sclerosis
    103677943 (PPP3CA)
   05020 Prion disease
    103677943 (PPP3CA)
   05022 Pathways of neurodegeneration - multiple diseases
    103677943 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    103677943 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103677943 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103677943 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    103677943 (PPP3CA)
   05163 Human cytomegalovirus infection
    103677943 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103677943 (PPP3CA)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     103677943 (PPP3CA)
Protein phosphatases and associated proteins [BR:umr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     103677943 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 103677943
NCBI-ProteinID: XP_008705430
UniProt: A0A384DF63
LinkDB
Position
Un
AA seq 624 aa
MTAGRMLGEQRKQINVTFVRLEFSLRSPSVHRYTNISPLFFFVPENSLWLTASLSSNYGV
IAAHLGSLGGLTICLTGEGPHLISVPTIQLETEPSGWPFSSLFCSSLFGTNSSMSEQVAS
PQPGTSDXQLLEAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITE
GASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSI
ECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPL
AALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEH
FTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFS
APNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVN
VLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLT
PTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLN
SINKALASETNGTDSNGSNSSNIQ
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgactgcaggtaggatgctaggtgaacagagaaagcaaataaatgtgacctttgtgagg
ctggaattctctttacgaagcccaagcgtgcacagatacacaaatattagcccactcttc
ttttttgtcccagaaaactctctctggcttacagcatctctgagttccaactacggcgtc
atcgctgcgcatcttggttccctggggggccttaccatctgtttaaccggtgaagggccc
catctcatcagtgtccctaccatccagctggaaacagagccctctggttggcctttttcc
tctcttttttgctcctctttatttggaaccaactcctctatgtcagagcaggtggcttca
cctcagccaggtacctcggattagcaattactggaagctgtcccatttcctccaagtcat
cggcttacagcaaaagaagtgtttgataacgatggaaaacctcgtgtggatatcttaaag
gcacatctcatgaaggagggcaggctggaagagagcgttgcattgagaataataacagag
ggggcttccattcttcgacaggaaaagaatttgctggatattgatgcaccagtcacagtt
tgtggggacatccatggacaattctttgacttgatgaagctttttgaagtggggggatct
cctgccaacactcgctacctcttcttgggggactatgttgacagagggtacttcagtatc
gaatgtgtgctgtatttgtgggccttgaaaattctttaccccaaaacactgtttttactt
cgcggaaatcatgaatgtagacatctaacagagtatttcacatttaaacaagaatgtaaa
ataaagtattcagaacgcgtatatgacgcctgtatggatgcctttgactgcctgcccctg
gctgctctgatgaaccaacagttcctgtgtgtccacgggggtttatctccagagattaac
actttagatgacatcaggaaattagaccgattcaaagaaccacctgcttatggacctatg
tgtgatatcctgtggtcagacccgctggaggattttggaaacgagaagactcaggaacat
ttcactcacaacacagtcagggggtgttcgtacttctacagttacccggctgtgtgtgaa
ttcttacagcacaataatttgttatctatactccgagcccatgaagcccaggatgcaggg
tatcgcatgtacaggaaaagccaaacgacaggcttcccttctctaatcacaattttctca
gcaccaaattacttagatgtatacaataacaaagctgcagtgttgaagtatgagaacaac
gtcatgaatatcaggcagttcaactgttctcctcacccctactggcttccaaatttcatg
gatgttttcacttggtccctgccatttgttggggaaaaagttaccgagatgcttgtaaat
gtcctcaacatctgctcagatgatgaactggggtcagaagaagatggatttgatggagca
acagccgcagcccggaaggaggtgataaggaacaagatccgagcaataggcaaaatggcc
cgagtgttctcggttctcagagaagagagcgagagtgtgctgacgctgaaaggcttgacc
cccacgggcatgctccccagcggagtgctttctggagggaagcagacactgcaaagcgct
atcaaaggattttcaccacaacataagatcactagcttcgaagaggccaagggcttagac
cgaattaacgagaggatgccacctcgcagagatgccatgccctctgacgccaaccttaac
tccatcaacaaggctctcgcctcagagactaacggcacggacagcaatggcagtaatagc
agcaatatccagtga

KEGG   Ursus maritimus (polar bear): 103678534
Entry
103678534         CDS       T03271                                 

Gene name
PPP3R2
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, beta
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04114  Oocyte meiosis
umr04218  Cellular senescence
umr04310  Wnt signaling pathway
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04380  Osteoclast differentiation
umr04625  C-type lectin receptor signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04720  Long-term potentiation
umr04724  Glutamatergic synapse
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04924  Renin secretion
umr05010  Alzheimer disease
umr05014  Amyotrophic lateral sclerosis
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05031  Amphetamine addiction
umr05152  Tuberculosis
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103678534 (PPP3R2)
   04310 Wnt signaling pathway
    103678534 (PPP3R2)
   04370 VEGF signaling pathway
    103678534 (PPP3R2)
   04020 Calcium signaling pathway
    103678534 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    103678534 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103678534 (PPP3R2)
   04218 Cellular senescence
    103678534 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103678534 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    103678534 (PPP3R2)
   04660 T cell receptor signaling pathway
    103678534 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    103678534 (PPP3R2)
   04659 Th17 cell differentiation
    103678534 (PPP3R2)
   04662 B cell receptor signaling pathway
    103678534 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103678534 (PPP3R2)
   04921 Oxytocin signaling pathway
    103678534 (PPP3R2)
   04924 Renin secretion
    103678534 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    103678534 (PPP3R2)
   04720 Long-term potentiation
    103678534 (PPP3R2)
  09158 Development and regeneration
   04360 Axon guidance
    103678534 (PPP3R2)
   04380 Osteoclast differentiation
    103678534 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103678534 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103678534 (PPP3R2)
   05014 Amyotrophic lateral sclerosis
    103678534 (PPP3R2)
   05020 Prion disease
    103678534 (PPP3R2)
   05022 Pathways of neurodegeneration - multiple diseases
    103678534 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    103678534 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103678534 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103678534 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    103678534 (PPP3R2)
   05163 Human cytomegalovirus infection
    103678534 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103678534 (PPP3R2)
Protein phosphatases and associated proteins [BR:umr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     103678534 (PPP3R2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045
Other DBs
NCBI-GeneID: 103678534
NCBI-ProteinID: XP_008706119
UniProt: A0A384DGZ9
LinkDB
Position
Un
AA seq 170 aa
MGNEASYPEEMCSHFNSDEIKRLGKRFKKLDLDSSGALSLEEFMSLPELQQNPLVQRVVD
VFDTDGNGEVDFKEFILGTSQFSVRGDEEQKLRFAFSIYDIDKDGYISNGELFQVLKLMV
GNNLKDWQLQQLVDKTIIILDQDGDGKISFEEFCTVVGGLEIHKKLVVIV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaagccagttacccggaggaaatgtgctcccacttcaactctgacgaaatc
aaaaggctgggcaagaggtttaagaagctggacttggactcttcgggcgcactgagcctg
gaggagttcatgtccctgcccgagctgcagcagaatccgttggtgcagcgagtggtcgac
gtcttcgacaccgacggcaacggagaagtggacttcaaggagttcatcctggggacctcc
cagttcagcgtcaggggggacgaggagcaaaagttgaggtttgccttcagcatctacgac
atcgataaagacggctacatttccaatggggagctcttccaggtgctgaagctgatggtg
ggcaacaacctgaaggactggcagctgcagcagctcgtggacaaaaccatcatcatcctg
gaccaggatggagacggcaaaatatccttcgaggaattctgcactgtggtcggaggcctg
gagatccacaagaagttggtggtgatagtgtga

DBGET integrated database retrieval system