Ursus maritimus (polar bear): 103667893 Help Entry 103667893         CDS       T03271                                  Gene name MAPK8 Definition (RefSeq) mitogen-activated protein kinase 8   KO K04440   mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24] Organism umr  Ursus maritimus (polar bear) Pathway umr01522   Endocrine resistance umr04010   MAPK signaling pathway umr04012   ErbB signaling pathway umr04014   Ras signaling pathway umr04024   cAMP signaling pathway umr04068   FoxO signaling pathway umr04071   Sphingolipid signaling pathway umr04137   Mitophagy - animal umr04140   Autophagy - animal umr04141   Protein processing in endoplasmic reticulum umr04210   Apoptosis umr04215   Apoptosis - multiple species umr04217   Necroptosis umr04310   Wnt signaling pathway umr04380   Osteoclast differentiation umr04510   Focal adhesion umr04530   Tight junction umr04620   Toll-like receptor signaling pathway umr04621   NOD-like receptor signaling pathway umr04622   RIG-I-like receptor signaling pathway umr04625   C-type lectin receptor signaling pathway umr04657   IL-17 signaling pathway umr04658   Th1 and Th2 cell differentiation umr04659   Th17 cell differentiation umr04660   T cell receptor signaling pathway umr04664   Fc epsilon RI signaling pathway umr04668   TNF signaling pathway umr04722   Neurotrophin signaling pathway umr04723   Retrograde endocannabinoid signaling umr04728   Dopaminergic synapse umr04750   Inflammatory mediator regulation of TRP channels umr04910   Insulin signaling pathway umr04912   GnRH signaling pathway umr04914   Progesterone-mediated oocyte maturation umr04917   Prolactin signaling pathway umr04920   Adipocytokine signaling pathway umr04926   Relaxin signaling pathway umr04930   Type II diabetes mellitus umr04931   Insulin resistance umr04932   Non-alcoholic fatty liver disease umr04933   AGE-RAGE signaling pathway in diabetic complications umr04935   Growth hormone synthesis, secretion and action umr05010   Alzheimer disease umr05012   Parkinson disease umr05016   Huntington disease umr05017   Spinocerebellar ataxia umr05020   Prion disease umr05022   Pathways of neurodegeneration - multiple diseases umr05132   Salmonella infection umr05133   Pertussis umr05135   Yersinia infection umr05142   Chagas disease umr05145   Toxoplasmosis umr05152   Tuberculosis umr05161   Hepatitis B umr05162   Measles umr05166   Human T-cell leukemia virus 1 infection umr05167   Kaposi sarcoma-associated herpesvirus infection umr05169   Epstein-Barr virus infection umr05170   Human immunodeficiency virus 1 infection umr05171   Coronavirus disease - COVID-19 umr05200   Pathways in cancer umr05210   Colorectal cancer umr05212   Pancreatic cancer umr05231   Choline metabolism in cancer umr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103667893 (MAPK8)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103667893 (MAPK8)    04012 ErbB signaling pathway     103667893 (MAPK8)    04014 Ras signaling pathway     103667893 (MAPK8)    04310 Wnt signaling pathway     103667893 (MAPK8)    04668 TNF signaling pathway     103667893 (MAPK8)    04068 FoxO signaling pathway     103667893 (MAPK8)    04071 Sphingolipid signaling pathway     103667893 (MAPK8)    04024 cAMP signaling pathway     103667893 (MAPK8)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103667893 (MAPK8)    04137 Mitophagy - animal     103667893 (MAPK8)   09143 Cell growth and death    04210 Apoptosis     103667893 (MAPK8)    04215 Apoptosis - multiple species     103667893 (MAPK8)    04217 Necroptosis     103667893 (MAPK8)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103667893 (MAPK8)    04530 Tight junction     103667893 (MAPK8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103667893 (MAPK8)    04621 NOD-like receptor signaling pathway     103667893 (MAPK8)    04622 RIG-I-like receptor signaling pathway     103667893 (MAPK8)    04625 C-type lectin receptor signaling pathway     103667893 (MAPK8)    04660 T cell receptor signaling pathway     103667893 (MAPK8)    04658 Th1 and Th2 cell differentiation     103667893 (MAPK8)    04659 Th17 cell differentiation     103667893 (MAPK8)    04657 IL-17 signaling pathway     103667893 (MAPK8)    04664 Fc epsilon RI signaling pathway     103667893 (MAPK8)   09152 Endocrine system    04910 Insulin signaling pathway     103667893 (MAPK8)    04920 Adipocytokine signaling pathway     103667893 (MAPK8)    04912 GnRH signaling pathway     103667893 (MAPK8)    04914 Progesterone-mediated oocyte maturation     103667893 (MAPK8)    04917 Prolactin signaling pathway     103667893 (MAPK8)    04926 Relaxin signaling pathway     103667893 (MAPK8)    04935 Growth hormone synthesis, secretion and action     103667893 (MAPK8)   09156 Nervous system    04728 Dopaminergic synapse     103667893 (MAPK8)    04723 Retrograde endocannabinoid signaling     103667893 (MAPK8)    04722 Neurotrophin signaling pathway     103667893 (MAPK8)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     103667893 (MAPK8)   09158 Development and regeneration    04380 Osteoclast differentiation     103667893 (MAPK8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103667893 (MAPK8)    05231 Choline metabolism in cancer     103667893 (MAPK8)   09162 Cancer: specific types    05210 Colorectal cancer     103667893 (MAPK8)    05212 Pancreatic cancer     103667893 (MAPK8)   09164 Neurodegenerative disease    05010 Alzheimer disease     103667893 (MAPK8)    05012 Parkinson disease     103667893 (MAPK8)    05016 Huntington disease     103667893 (MAPK8)    05017 Spinocerebellar ataxia     103667893 (MAPK8)    05020 Prion disease     103667893 (MAPK8)    05022 Pathways of neurodegeneration - multiple diseases     103667893 (MAPK8)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103667893 (MAPK8)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     103667893 (MAPK8)    04932 Non-alcoholic fatty liver disease     103667893 (MAPK8)    04931 Insulin resistance     103667893 (MAPK8)    04933 AGE-RAGE signaling pathway in diabetic complications     103667893 (MAPK8)   09171 Infectious disease: bacterial    05132 Salmonella infection     103667893 (MAPK8)    05135 Yersinia infection     103667893 (MAPK8)    05133 Pertussis     103667893 (MAPK8)    05152 Tuberculosis     103667893 (MAPK8)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103667893 (MAPK8)    05170 Human immunodeficiency virus 1 infection     103667893 (MAPK8)    05161 Hepatitis B     103667893 (MAPK8)    05171 Coronavirus disease - COVID-19     103667893 (MAPK8)    05162 Measles     103667893 (MAPK8)    05167 Kaposi sarcoma-associated herpesvirus infection     103667893 (MAPK8)    05169 Epstein-Barr virus infection     103667893 (MAPK8)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103667893 (MAPK8)    05142 Chagas disease     103667893 (MAPK8)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     103667893 (MAPK8)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:umr01001]     103667893 (MAPK8) Enzymes [BR:umr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      103667893 (MAPK8) Protein kinases [BR:umr01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    103667893 (MAPK8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530 Motif Other DBs NCBI-GeneID:  103667893 NCBI-ProteinID:  XP_008694376 UniProt:  A0A384CHN5 LinkDB All DBs Position Un AA seq 427 aa AA seqDB search MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA GPLGCCR NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt atgagcagaagcaagcgtgacagcaatttttatagtgtagagattggagattctaccttt acagtcttgaaacggtatcagaatttaaaacctataggctcaggagctcaaggaatagta tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccggcca tttcagaatcagactcatgctaaacgggcttacagagagctagttcttatgaaatgtgtt aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtggtaaaa tcagactgcactttgaagattcttgactttggactggccaggaccgcaggaactagtttt atgatgacaccttacgtagtgactcgctactacagagcacctgaggtcatcctagggatg ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag cttggaacaccatgccctgaattcatgaagaaactacagccaacagtaaggacttatgtt gaaaacagacctaaatatgctggatatagctttgagaaactcttccccgatgtacttttc ccagctgactcggaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa atgctggtaattgatgcatctaaaaggatctctgtagatgaagctctccagcacccgtat atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatacctgataag cagttagatgaaagggaacatacaatagaagaatggaaagagttgatatacaaagaagtt atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt gcagcagtgatcaatggctctcagcatccatcgtcatcatcgtccgtcaatgatgtgtct tcaatgtcaacagatccaactttggcctcagatacagacagcagtctagaagcatcagct ggacctctgggctgctgtagatga

Ursus maritimus (polar bear): 103676947 Help Entry 103676947         CDS       T03271                                  Gene name MAPK10 Definition (RefSeq) mitogen-activated protein kinase 10   KO K04440   mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24] Organism umr  Ursus maritimus (polar bear) Pathway umr01522   Endocrine resistance umr04010   MAPK signaling pathway umr04012   ErbB signaling pathway umr04014   Ras signaling pathway umr04024   cAMP signaling pathway umr04068   FoxO signaling pathway umr04071   Sphingolipid signaling pathway umr04137   Mitophagy - animal umr04140   Autophagy - animal umr04141   Protein processing in endoplasmic reticulum umr04210   Apoptosis umr04215   Apoptosis - multiple species umr04217   Necroptosis umr04310   Wnt signaling pathway umr04380   Osteoclast differentiation umr04510   Focal adhesion umr04530   Tight junction umr04620   Toll-like receptor signaling pathway umr04621   NOD-like receptor signaling pathway umr04622   RIG-I-like receptor signaling pathway umr04625   C-type lectin receptor signaling pathway umr04657   IL-17 signaling pathway umr04658   Th1 and Th2 cell differentiation umr04659   Th17 cell differentiation umr04660   T cell receptor signaling pathway umr04664   Fc epsilon RI signaling pathway umr04668   TNF signaling pathway umr04722   Neurotrophin signaling pathway umr04723   Retrograde endocannabinoid signaling umr04728   Dopaminergic synapse umr04750   Inflammatory mediator regulation of TRP channels umr04910   Insulin signaling pathway umr04912   GnRH signaling pathway umr04914   Progesterone-mediated oocyte maturation umr04917   Prolactin signaling pathway umr04920   Adipocytokine signaling pathway umr04926   Relaxin signaling pathway umr04930   Type II diabetes mellitus umr04931   Insulin resistance umr04932   Non-alcoholic fatty liver disease umr04933   AGE-RAGE signaling pathway in diabetic complications umr04935   Growth hormone synthesis, secretion and action umr05010   Alzheimer disease umr05012   Parkinson disease umr05016   Huntington disease umr05017   Spinocerebellar ataxia umr05020   Prion disease umr05022   Pathways of neurodegeneration - multiple diseases umr05132   Salmonella infection umr05133   Pertussis umr05135   Yersinia infection umr05142   Chagas disease umr05145   Toxoplasmosis umr05152   Tuberculosis umr05161   Hepatitis B umr05162   Measles umr05166   Human T-cell leukemia virus 1 infection umr05167   Kaposi sarcoma-associated herpesvirus infection umr05169   Epstein-Barr virus infection umr05170   Human immunodeficiency virus 1 infection umr05171   Coronavirus disease - COVID-19 umr05200   Pathways in cancer umr05210   Colorectal cancer umr05212   Pancreatic cancer umr05231   Choline metabolism in cancer umr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103676947 (MAPK10)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103676947 (MAPK10)    04012 ErbB signaling pathway     103676947 (MAPK10)    04014 Ras signaling pathway     103676947 (MAPK10)    04310 Wnt signaling pathway     103676947 (MAPK10)    04668 TNF signaling pathway     103676947 (MAPK10)    04068 FoxO signaling pathway     103676947 (MAPK10)    04071 Sphingolipid signaling pathway     103676947 (MAPK10)    04024 cAMP signaling pathway     103676947 (MAPK10)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103676947 (MAPK10)    04137 Mitophagy - animal     103676947 (MAPK10)   09143 Cell growth and death    04210 Apoptosis     103676947 (MAPK10)    04215 Apoptosis - multiple species     103676947 (MAPK10)    04217 Necroptosis     103676947 (MAPK10)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103676947 (MAPK10)    04530 Tight junction     103676947 (MAPK10)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103676947 (MAPK10)    04621 NOD-like receptor signaling pathway     103676947 (MAPK10)    04622 RIG-I-like receptor signaling pathway     103676947 (MAPK10)    04625 C-type lectin receptor signaling pathway     103676947 (MAPK10)    04660 T cell receptor signaling pathway     103676947 (MAPK10)    04658 Th1 and Th2 cell differentiation     103676947 (MAPK10)    04659 Th17 cell differentiation     103676947 (MAPK10)    04657 IL-17 signaling pathway     103676947 (MAPK10)    04664 Fc epsilon RI signaling pathway     103676947 (MAPK10)   09152 Endocrine system    04910 Insulin signaling pathway     103676947 (MAPK10)    04920 Adipocytokine signaling pathway     103676947 (MAPK10)    04912 GnRH signaling pathway     103676947 (MAPK10)    04914 Progesterone-mediated oocyte maturation     103676947 (MAPK10)    04917 Prolactin signaling pathway     103676947 (MAPK10)    04926 Relaxin signaling pathway     103676947 (MAPK10)    04935 Growth hormone synthesis, secretion and action     103676947 (MAPK10)   09156 Nervous system    04728 Dopaminergic synapse     103676947 (MAPK10)    04723 Retrograde endocannabinoid signaling     103676947 (MAPK10)    04722 Neurotrophin signaling pathway     103676947 (MAPK10)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     103676947 (MAPK10)   09158 Development and regeneration    04380 Osteoclast differentiation     103676947 (MAPK10)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103676947 (MAPK10)    05231 Choline metabolism in cancer     103676947 (MAPK10)   09162 Cancer: specific types    05210 Colorectal cancer     103676947 (MAPK10)    05212 Pancreatic cancer     103676947 (MAPK10)   09164 Neurodegenerative disease    05010 Alzheimer disease     103676947 (MAPK10)    05012 Parkinson disease     103676947 (MAPK10)    05016 Huntington disease     103676947 (MAPK10)    05017 Spinocerebellar ataxia     103676947 (MAPK10)    05020 Prion disease     103676947 (MAPK10)    05022 Pathways of neurodegeneration - multiple diseases     103676947 (MAPK10)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103676947 (MAPK10)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     103676947 (MAPK10)    04932 Non-alcoholic fatty liver disease     103676947 (MAPK10)    04931 Insulin resistance     103676947 (MAPK10)    04933 AGE-RAGE signaling pathway in diabetic complications     103676947 (MAPK10)   09171 Infectious disease: bacterial    05132 Salmonella infection     103676947 (MAPK10)    05135 Yersinia infection     103676947 (MAPK10)    05133 Pertussis     103676947 (MAPK10)    05152 Tuberculosis     103676947 (MAPK10)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103676947 (MAPK10)    05170 Human immunodeficiency virus 1 infection     103676947 (MAPK10)    05161 Hepatitis B     103676947 (MAPK10)    05171 Coronavirus disease - COVID-19     103676947 (MAPK10)    05162 Measles     103676947 (MAPK10)    05167 Kaposi sarcoma-associated herpesvirus infection     103676947 (MAPK10)    05169 Epstein-Barr virus infection     103676947 (MAPK10)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103676947 (MAPK10)    05142 Chagas disease     103676947 (MAPK10)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     103676947 (MAPK10)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:umr01001]     103676947 (MAPK10) Enzymes [BR:umr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      103676947 (MAPK10) Protein kinases [BR:umr01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    103676947 (MAPK10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 Motif Other DBs NCBI-GeneID:  103676947 NCBI-ProteinID:  XP_008704385 UniProt:  A0A384DBH6 LinkDB All DBs Position Un AA seq 464 aa AA seqDB search MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVEDALQHPYIN VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt atgagcctccatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc aaaagcaaagttgacaaccaattctacagtgtggaagtgggagactcaaccttcacggtt ctcaagcgctaccagaatctgaagcctattggctctggggctcagggaatagtttgtgct gcgtacgatgctgttcttgacagaaatgtggccattaagaagctcagcagaccctttcag aaccaaacgcatgccaagagagcttaccgggagctggtcctcatgaagtgtgtgaaccat aaaaacattattagtttattaaatgtcttcacaccccagaaaacactggaggagttccaa gatgtttacttagtaatggaactgatggatgccaacttgtgtcaggtgattcagatggaa ttagaccacgagcgaatgtcttacctgctgtaccaaatgttgtgtggcatcaagcacctt cactctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat tgtacgttgaaaatcctcgactttggactggccaggacggcaggcacaagcttcatgatg actccttatgtggttacacgttattatagagcccccgaggttattctgggaatgggctac aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa atcctctttccaggaagggactatattgaccagtggaacaaggtaattgaacaactagga acaccatgtccggaattcatgaagaaattgcaacctacagtaagaaactatgtggagaat cggcccaagtatgcaggactcaccttccccaagctctttccagattccctcttcccagcg gactctgagcacaataaactcaaagccagccaagccagggacttactgtcaaagatgcta gtgattgaccccgcaaaaaggatatcagtggaggacgccttgcagcacccttacatcaat gtgtggtacgaccctgccgaagtggaagcgcctccacctcagatttatgacaaacagttg gatgaaagagaacacaccattgaagaatggaaagaacttatctacaaggaagtaatgaat tcggaagaaaagactaaaaacggtgttgtaaaaggacaaccttctccttcaggtgcagca gtgaacagcagtgagagtctccctccgtcttcgtccgtcaacgacatctcctccatgtcc accgaccagaccctggcatccgacactgacagcagcctggaagcctcagcaggacccctg ggttgttgcaggtga

Ursus maritimus (polar bear): 103679990 Help Entry 103679990         CDS       T03271                                  Gene name MAPK9 Definition (RefSeq) mitogen-activated protein kinase 9   KO K04440   mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24] Organism umr  Ursus maritimus (polar bear) Pathway umr01522   Endocrine resistance umr04010   MAPK signaling pathway umr04012   ErbB signaling pathway umr04014   Ras signaling pathway umr04024   cAMP signaling pathway umr04068   FoxO signaling pathway umr04071   Sphingolipid signaling pathway umr04137   Mitophagy - animal umr04140   Autophagy - animal umr04141   Protein processing in endoplasmic reticulum umr04210   Apoptosis umr04215   Apoptosis - multiple species umr04217   Necroptosis umr04310   Wnt signaling pathway umr04380   Osteoclast differentiation umr04510   Focal adhesion umr04530   Tight junction umr04620   Toll-like receptor signaling pathway umr04621   NOD-like receptor signaling pathway umr04622   RIG-I-like receptor signaling pathway umr04625   C-type lectin receptor signaling pathway umr04657   IL-17 signaling pathway umr04658   Th1 and Th2 cell differentiation umr04659   Th17 cell differentiation umr04660   T cell receptor signaling pathway umr04664   Fc epsilon RI signaling pathway umr04668   TNF signaling pathway umr04722   Neurotrophin signaling pathway umr04723   Retrograde endocannabinoid signaling umr04728   Dopaminergic synapse umr04750   Inflammatory mediator regulation of TRP channels umr04910   Insulin signaling pathway umr04912   GnRH signaling pathway umr04914   Progesterone-mediated oocyte maturation umr04917   Prolactin signaling pathway umr04920   Adipocytokine signaling pathway umr04926   Relaxin signaling pathway umr04930   Type II diabetes mellitus umr04931   Insulin resistance umr04932   Non-alcoholic fatty liver disease umr04933   AGE-RAGE signaling pathway in diabetic complications umr04935   Growth hormone synthesis, secretion and action umr05010   Alzheimer disease umr05012   Parkinson disease umr05016   Huntington disease umr05017   Spinocerebellar ataxia umr05020   Prion disease umr05022   Pathways of neurodegeneration - multiple diseases umr05132   Salmonella infection umr05133   Pertussis umr05135   Yersinia infection umr05142   Chagas disease umr05145   Toxoplasmosis umr05152   Tuberculosis umr05161   Hepatitis B umr05162   Measles umr05166   Human T-cell leukemia virus 1 infection umr05167   Kaposi sarcoma-associated herpesvirus infection umr05169   Epstein-Barr virus infection umr05170   Human immunodeficiency virus 1 infection umr05171   Coronavirus disease - COVID-19 umr05200   Pathways in cancer umr05210   Colorectal cancer umr05212   Pancreatic cancer umr05231   Choline metabolism in cancer umr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103679990 (MAPK9)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103679990 (MAPK9)    04012 ErbB signaling pathway     103679990 (MAPK9)    04014 Ras signaling pathway     103679990 (MAPK9)    04310 Wnt signaling pathway     103679990 (MAPK9)    04668 TNF signaling pathway     103679990 (MAPK9)    04068 FoxO signaling pathway     103679990 (MAPK9)    04071 Sphingolipid signaling pathway     103679990 (MAPK9)    04024 cAMP signaling pathway     103679990 (MAPK9)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103679990 (MAPK9)    04137 Mitophagy - animal     103679990 (MAPK9)   09143 Cell growth and death    04210 Apoptosis     103679990 (MAPK9)    04215 Apoptosis - multiple species     103679990 (MAPK9)    04217 Necroptosis     103679990 (MAPK9)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103679990 (MAPK9)    04530 Tight junction     103679990 (MAPK9)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103679990 (MAPK9)    04621 NOD-like receptor signaling pathway     103679990 (MAPK9)    04622 RIG-I-like receptor signaling pathway     103679990 (MAPK9)    04625 C-type lectin receptor signaling pathway     103679990 (MAPK9)    04660 T cell receptor signaling pathway     103679990 (MAPK9)    04658 Th1 and Th2 cell differentiation     103679990 (MAPK9)    04659 Th17 cell differentiation     103679990 (MAPK9)    04657 IL-17 signaling pathway     103679990 (MAPK9)    04664 Fc epsilon RI signaling pathway     103679990 (MAPK9)   09152 Endocrine system    04910 Insulin signaling pathway     103679990 (MAPK9)    04920 Adipocytokine signaling pathway     103679990 (MAPK9)    04912 GnRH signaling pathway     103679990 (MAPK9)    04914 Progesterone-mediated oocyte maturation     103679990 (MAPK9)    04917 Prolactin signaling pathway     103679990 (MAPK9)    04926 Relaxin signaling pathway     103679990 (MAPK9)    04935 Growth hormone synthesis, secretion and action     103679990 (MAPK9)   09156 Nervous system    04728 Dopaminergic synapse     103679990 (MAPK9)    04723 Retrograde endocannabinoid signaling     103679990 (MAPK9)    04722 Neurotrophin signaling pathway     103679990 (MAPK9)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     103679990 (MAPK9)   09158 Development and regeneration    04380 Osteoclast differentiation     103679990 (MAPK9)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103679990 (MAPK9)    05231 Choline metabolism in cancer     103679990 (MAPK9)   09162 Cancer: specific types    05210 Colorectal cancer     103679990 (MAPK9)    05212 Pancreatic cancer     103679990 (MAPK9)   09164 Neurodegenerative disease    05010 Alzheimer disease     103679990 (MAPK9)    05012 Parkinson disease     103679990 (MAPK9)    05016 Huntington disease     103679990 (MAPK9)    05017 Spinocerebellar ataxia     103679990 (MAPK9)    05020 Prion disease     103679990 (MAPK9)    05022 Pathways of neurodegeneration - multiple diseases     103679990 (MAPK9)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103679990 (MAPK9)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     103679990 (MAPK9)    04932 Non-alcoholic fatty liver disease     103679990 (MAPK9)    04931 Insulin resistance     103679990 (MAPK9)    04933 AGE-RAGE signaling pathway in diabetic complications     103679990 (MAPK9)   09171 Infectious disease: bacterial    05132 Salmonella infection     103679990 (MAPK9)    05135 Yersinia infection     103679990 (MAPK9)    05133 Pertussis     103679990 (MAPK9)    05152 Tuberculosis     103679990 (MAPK9)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103679990 (MAPK9)    05170 Human immunodeficiency virus 1 infection     103679990 (MAPK9)    05161 Hepatitis B     103679990 (MAPK9)    05171 Coronavirus disease - COVID-19     103679990 (MAPK9)    05162 Measles     103679990 (MAPK9)    05167 Kaposi sarcoma-associated herpesvirus infection     103679990 (MAPK9)    05169 Epstein-Barr virus infection     103679990 (MAPK9)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103679990 (MAPK9)    05142 Chagas disease     103679990 (MAPK9)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     103679990 (MAPK9)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:umr01001]     103679990 (MAPK9) Enzymes [BR:umr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      103679990 (MAPK9) Protein kinases [BR:umr01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    103679990 (MAPK9) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 Motif Other DBs NCBI-GeneID:  103679990 NCBI-ProteinID:  XP_008707741 UniProt:  A0A384DL69 LinkDB All DBs Position Un AA seq 424 aa AA seqDB search MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ LGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV LDWEERSKNGVVKDQPSDAAVSSNATPSRSSSINDISSMSTEQTLASDTDSSLDASTGPL EGCR NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt atgagtgacagtaaatgtgacagtcagttttacagtgtacaagtggcagactcaaccttc acggtcctcaaacgttaccagcagttgaagccaatcggctccggagcccaaggaatagtt tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct tttcagaatcaaactcatgcaaagagagcttaccgtgaactcgtcctcttaaaatgtgtc aatcataaaaatataattagtttattaaatgtgtttacaccacaaaagactctagaagaa tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcac atggagttggaccatgaaagaatgtcctaccttctttaccagatgctctgtggtattaaa catctgcattcagctggtatcattcatagagacttgaaaccgagcaacatcgtggtaaaa tcagactgcacgcttaagatccttgactttggcctggcccggacagcatgcaccaacttc atgatgacgccgtacgtggtgacgcgctattaccgggcgcccgaagtcatcctcggcatg ggctacaaggagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa ggttgtgtgattttccaaggcactgatcatattgatcagtggaataaagtcattgagcag ctgggaacgccgtccgcggattttatgaagaaacttcagccgaccgtgaggaattatgta gaaaacagaccgaagtaccccggcatcaaatttgaagagctcttccccgattggatattc ccatcagaatccgagcgagacaaaattaaaacaagtcaagccagagatttgttatcgaaa atgttagtgatagatcccgacaagcgaatctctgtagacgaagctttacgtcacccttat attaccgtttggtatgaccctgctgaagccgaggcgccaccacctcagatttacgatgcc cagctggaagaaagagagcatgcaattgaagagtggaaagagctgatttacaaagaagtg ctggattgggaagaacgaagcaagaacggtgtggtcaaagatcagccttcagatgcagca gtaagtagcaacgccactccttcccggtcgtcgtccatcaacgacatctcgtccatgtcc actgagcagacgctggcctcagacacagacagcagcctcgacgcctcgacgggacccctc gaaggttgccgatga

DBGET integrated database retrieval system