KEGG   Ursus maritimus (polar bear): 103667893
Entry
103667893         CDS       T03271                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04024  cAMP signaling pathway
umr04068  FoxO signaling pathway
umr04071  Sphingolipid signaling pathway
umr04137  Mitophagy - animal
umr04140  Autophagy - animal
umr04141  Protein processing in endoplasmic reticulum
umr04210  Apoptosis
umr04215  Apoptosis - multiple species
umr04217  Necroptosis
umr04310  Wnt signaling pathway
umr04380  Osteoclast differentiation
umr04510  Focal adhesion
umr04530  Tight junction
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04657  IL-17 signaling pathway
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04668  TNF signaling pathway
umr04722  Neurotrophin signaling pathway
umr04723  Retrograde endocannabinoid signaling
umr04728  Dopaminergic synapse
umr04750  Inflammatory mediator regulation of TRP channels
umr04910  Insulin signaling pathway
umr04912  GnRH signaling pathway
umr04914  Progesterone-mediated oocyte maturation
umr04917  Prolactin signaling pathway
umr04920  Adipocytokine signaling pathway
umr04926  Relaxin signaling pathway
umr04930  Type II diabetes mellitus
umr04931  Insulin resistance
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr05010  Alzheimer disease
umr05012  Parkinson disease
umr05016  Huntington disease
umr05017  Spinocerebellar ataxia
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05132  Salmonella infection
umr05133  Pertussis
umr05135  Yersinia infection
umr05142  Chagas disease
umr05145  Toxoplasmosis
umr05152  Tuberculosis
umr05161  Hepatitis B
umr05162  Measles
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05231  Choline metabolism in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103667893 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103667893 (MAPK8)
   04012 ErbB signaling pathway
    103667893 (MAPK8)
   04014 Ras signaling pathway
    103667893 (MAPK8)
   04310 Wnt signaling pathway
    103667893 (MAPK8)
   04668 TNF signaling pathway
    103667893 (MAPK8)
   04068 FoxO signaling pathway
    103667893 (MAPK8)
   04071 Sphingolipid signaling pathway
    103667893 (MAPK8)
   04024 cAMP signaling pathway
    103667893 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103667893 (MAPK8)
   04137 Mitophagy - animal
    103667893 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    103667893 (MAPK8)
   04215 Apoptosis - multiple species
    103667893 (MAPK8)
   04217 Necroptosis
    103667893 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103667893 (MAPK8)
   04530 Tight junction
    103667893 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103667893 (MAPK8)
   04621 NOD-like receptor signaling pathway
    103667893 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    103667893 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    103667893 (MAPK8)
   04660 T cell receptor signaling pathway
    103667893 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    103667893 (MAPK8)
   04659 Th17 cell differentiation
    103667893 (MAPK8)
   04657 IL-17 signaling pathway
    103667893 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    103667893 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103667893 (MAPK8)
   04920 Adipocytokine signaling pathway
    103667893 (MAPK8)
   04912 GnRH signaling pathway
    103667893 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    103667893 (MAPK8)
   04917 Prolactin signaling pathway
    103667893 (MAPK8)
   04926 Relaxin signaling pathway
    103667893 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    103667893 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    103667893 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    103667893 (MAPK8)
   04722 Neurotrophin signaling pathway
    103667893 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103667893 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103667893 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103667893 (MAPK8)
   05231 Choline metabolism in cancer
    103667893 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103667893 (MAPK8)
   05212 Pancreatic cancer
    103667893 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103667893 (MAPK8)
   05012 Parkinson disease
    103667893 (MAPK8)
   05016 Huntington disease
    103667893 (MAPK8)
   05017 Spinocerebellar ataxia
    103667893 (MAPK8)
   05020 Prion disease
    103667893 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    103667893 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103667893 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103667893 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    103667893 (MAPK8)
   04931 Insulin resistance
    103667893 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103667893 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103667893 (MAPK8)
   05135 Yersinia infection
    103667893 (MAPK8)
   05133 Pertussis
    103667893 (MAPK8)
   05152 Tuberculosis
    103667893 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103667893 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    103667893 (MAPK8)
   05161 Hepatitis B
    103667893 (MAPK8)
   05171 Coronavirus disease - COVID-19
    103667893 (MAPK8)
   05162 Measles
    103667893 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103667893 (MAPK8)
   05169 Epstein-Barr virus infection
    103667893 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103667893 (MAPK8)
   05142 Chagas disease
    103667893 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103667893 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103667893 (MAPK8)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103667893 (MAPK8)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103667893 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 103667893
NCBI-ProteinID: XP_008694376
UniProt: A0A384CHN5
LinkDB
Position
Un
AA seq 427 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacagcaatttttatagtgtagagattggagattctaccttt
acagtcttgaaacggtatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccggcca
tttcagaatcagactcatgctaaacgggcttacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtggtaaaa
tcagactgcactttgaagattcttgactttggactggccaggaccgcaggaactagtttt
atgatgacaccttacgtagtgactcgctactacagagcacctgaggtcatcctagggatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgccctgaattcatgaagaaactacagccaacagtaaggacttatgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccccgatgtacttttc
ccagctgactcggaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaattgatgcatctaaaaggatctctgtagatgaagctctccagcacccgtat
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatacctgataag
cagttagatgaaagggaacatacaatagaagaatggaaagagttgatatacaaagaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcatcgtccgtcaatgatgtgtct
tcaatgtcaacagatccaactttggcctcagatacagacagcagtctagaagcatcagct
ggacctctgggctgctgtagatga

KEGG   Ursus maritimus (polar bear): 103676947
Entry
103676947         CDS       T03271                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04024  cAMP signaling pathway
umr04068  FoxO signaling pathway
umr04071  Sphingolipid signaling pathway
umr04137  Mitophagy - animal
umr04140  Autophagy - animal
umr04141  Protein processing in endoplasmic reticulum
umr04210  Apoptosis
umr04215  Apoptosis - multiple species
umr04217  Necroptosis
umr04310  Wnt signaling pathway
umr04380  Osteoclast differentiation
umr04510  Focal adhesion
umr04530  Tight junction
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04657  IL-17 signaling pathway
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04668  TNF signaling pathway
umr04722  Neurotrophin signaling pathway
umr04723  Retrograde endocannabinoid signaling
umr04728  Dopaminergic synapse
umr04750  Inflammatory mediator regulation of TRP channels
umr04910  Insulin signaling pathway
umr04912  GnRH signaling pathway
umr04914  Progesterone-mediated oocyte maturation
umr04917  Prolactin signaling pathway
umr04920  Adipocytokine signaling pathway
umr04926  Relaxin signaling pathway
umr04930  Type II diabetes mellitus
umr04931  Insulin resistance
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr05010  Alzheimer disease
umr05012  Parkinson disease
umr05016  Huntington disease
umr05017  Spinocerebellar ataxia
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05132  Salmonella infection
umr05133  Pertussis
umr05135  Yersinia infection
umr05142  Chagas disease
umr05145  Toxoplasmosis
umr05152  Tuberculosis
umr05161  Hepatitis B
umr05162  Measles
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05231  Choline metabolism in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103676947 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103676947 (MAPK10)
   04012 ErbB signaling pathway
    103676947 (MAPK10)
   04014 Ras signaling pathway
    103676947 (MAPK10)
   04310 Wnt signaling pathway
    103676947 (MAPK10)
   04668 TNF signaling pathway
    103676947 (MAPK10)
   04068 FoxO signaling pathway
    103676947 (MAPK10)
   04071 Sphingolipid signaling pathway
    103676947 (MAPK10)
   04024 cAMP signaling pathway
    103676947 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103676947 (MAPK10)
   04137 Mitophagy - animal
    103676947 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    103676947 (MAPK10)
   04215 Apoptosis - multiple species
    103676947 (MAPK10)
   04217 Necroptosis
    103676947 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103676947 (MAPK10)
   04530 Tight junction
    103676947 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103676947 (MAPK10)
   04621 NOD-like receptor signaling pathway
    103676947 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    103676947 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    103676947 (MAPK10)
   04660 T cell receptor signaling pathway
    103676947 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    103676947 (MAPK10)
   04659 Th17 cell differentiation
    103676947 (MAPK10)
   04657 IL-17 signaling pathway
    103676947 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    103676947 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103676947 (MAPK10)
   04920 Adipocytokine signaling pathway
    103676947 (MAPK10)
   04912 GnRH signaling pathway
    103676947 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    103676947 (MAPK10)
   04917 Prolactin signaling pathway
    103676947 (MAPK10)
   04926 Relaxin signaling pathway
    103676947 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    103676947 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    103676947 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    103676947 (MAPK10)
   04722 Neurotrophin signaling pathway
    103676947 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103676947 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103676947 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103676947 (MAPK10)
   05231 Choline metabolism in cancer
    103676947 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103676947 (MAPK10)
   05212 Pancreatic cancer
    103676947 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103676947 (MAPK10)
   05012 Parkinson disease
    103676947 (MAPK10)
   05016 Huntington disease
    103676947 (MAPK10)
   05017 Spinocerebellar ataxia
    103676947 (MAPK10)
   05020 Prion disease
    103676947 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    103676947 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103676947 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103676947 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    103676947 (MAPK10)
   04931 Insulin resistance
    103676947 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103676947 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103676947 (MAPK10)
   05135 Yersinia infection
    103676947 (MAPK10)
   05133 Pertussis
    103676947 (MAPK10)
   05152 Tuberculosis
    103676947 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103676947 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    103676947 (MAPK10)
   05161 Hepatitis B
    103676947 (MAPK10)
   05171 Coronavirus disease - COVID-19
    103676947 (MAPK10)
   05162 Measles
    103676947 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103676947 (MAPK10)
   05169 Epstein-Barr virus infection
    103676947 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103676947 (MAPK10)
   05142 Chagas disease
    103676947 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103676947 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103676947 (MAPK10)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103676947 (MAPK10)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103676947 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 103676947
NCBI-ProteinID: XP_008704385
UniProt: A0A384DBH6
LinkDB
Position
Un
AA seq 464 aa
MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVEDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccaattctacagtgtggaagtgggagactcaaccttcacggtt
ctcaagcgctaccagaatctgaagcctattggctctggggctcagggaatagtttgtgct
gcgtacgatgctgttcttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacgcatgccaagagagcttaccgggagctggtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacactggaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttgtgtcaggtgattcagatggaa
ttagaccacgagcgaatgtcttacctgctgtaccaaatgttgtgtggcatcaagcacctt
cactctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgtacgttgaaaatcctcgactttggactggccaggacggcaggcacaagcttcatgatg
actccttatgtggttacacgttattatagagcccccgaggttattctgggaatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatattgaccagtggaacaaggtaattgaacaactagga
acaccatgtccggaattcatgaagaaattgcaacctacagtaagaaactatgtggagaat
cggcccaagtatgcaggactcaccttccccaagctctttccagattccctcttcccagcg
gactctgagcacaataaactcaaagccagccaagccagggacttactgtcaaagatgcta
gtgattgaccccgcaaaaaggatatcagtggaggacgccttgcagcacccttacatcaat
gtgtggtacgaccctgccgaagtggaagcgcctccacctcagatttatgacaaacagttg
gatgaaagagaacacaccattgaagaatggaaagaacttatctacaaggaagtaatgaat
tcggaagaaaagactaaaaacggtgttgtaaaaggacaaccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccgtcttcgtccgtcaacgacatctcctccatgtcc
accgaccagaccctggcatccgacactgacagcagcctggaagcctcagcaggacccctg
ggttgttgcaggtga

KEGG   Ursus maritimus (polar bear): 103679990
Entry
103679990         CDS       T03271                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04024  cAMP signaling pathway
umr04068  FoxO signaling pathway
umr04071  Sphingolipid signaling pathway
umr04137  Mitophagy - animal
umr04140  Autophagy - animal
umr04141  Protein processing in endoplasmic reticulum
umr04210  Apoptosis
umr04215  Apoptosis - multiple species
umr04217  Necroptosis
umr04310  Wnt signaling pathway
umr04380  Osteoclast differentiation
umr04510  Focal adhesion
umr04530  Tight junction
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04657  IL-17 signaling pathway
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04668  TNF signaling pathway
umr04722  Neurotrophin signaling pathway
umr04723  Retrograde endocannabinoid signaling
umr04728  Dopaminergic synapse
umr04750  Inflammatory mediator regulation of TRP channels
umr04910  Insulin signaling pathway
umr04912  GnRH signaling pathway
umr04914  Progesterone-mediated oocyte maturation
umr04917  Prolactin signaling pathway
umr04920  Adipocytokine signaling pathway
umr04926  Relaxin signaling pathway
umr04930  Type II diabetes mellitus
umr04931  Insulin resistance
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr05010  Alzheimer disease
umr05012  Parkinson disease
umr05016  Huntington disease
umr05017  Spinocerebellar ataxia
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05132  Salmonella infection
umr05133  Pertussis
umr05135  Yersinia infection
umr05142  Chagas disease
umr05145  Toxoplasmosis
umr05152  Tuberculosis
umr05161  Hepatitis B
umr05162  Measles
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05231  Choline metabolism in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103679990 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103679990 (MAPK9)
   04012 ErbB signaling pathway
    103679990 (MAPK9)
   04014 Ras signaling pathway
    103679990 (MAPK9)
   04310 Wnt signaling pathway
    103679990 (MAPK9)
   04668 TNF signaling pathway
    103679990 (MAPK9)
   04068 FoxO signaling pathway
    103679990 (MAPK9)
   04071 Sphingolipid signaling pathway
    103679990 (MAPK9)
   04024 cAMP signaling pathway
    103679990 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103679990 (MAPK9)
   04137 Mitophagy - animal
    103679990 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    103679990 (MAPK9)
   04215 Apoptosis - multiple species
    103679990 (MAPK9)
   04217 Necroptosis
    103679990 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103679990 (MAPK9)
   04530 Tight junction
    103679990 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103679990 (MAPK9)
   04621 NOD-like receptor signaling pathway
    103679990 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    103679990 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    103679990 (MAPK9)
   04660 T cell receptor signaling pathway
    103679990 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    103679990 (MAPK9)
   04659 Th17 cell differentiation
    103679990 (MAPK9)
   04657 IL-17 signaling pathway
    103679990 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    103679990 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103679990 (MAPK9)
   04920 Adipocytokine signaling pathway
    103679990 (MAPK9)
   04912 GnRH signaling pathway
    103679990 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    103679990 (MAPK9)
   04917 Prolactin signaling pathway
    103679990 (MAPK9)
   04926 Relaxin signaling pathway
    103679990 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    103679990 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    103679990 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    103679990 (MAPK9)
   04722 Neurotrophin signaling pathway
    103679990 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103679990 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103679990 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103679990 (MAPK9)
   05231 Choline metabolism in cancer
    103679990 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103679990 (MAPK9)
   05212 Pancreatic cancer
    103679990 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103679990 (MAPK9)
   05012 Parkinson disease
    103679990 (MAPK9)
   05016 Huntington disease
    103679990 (MAPK9)
   05017 Spinocerebellar ataxia
    103679990 (MAPK9)
   05020 Prion disease
    103679990 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    103679990 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103679990 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103679990 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    103679990 (MAPK9)
   04931 Insulin resistance
    103679990 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103679990 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103679990 (MAPK9)
   05135 Yersinia infection
    103679990 (MAPK9)
   05133 Pertussis
    103679990 (MAPK9)
   05152 Tuberculosis
    103679990 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103679990 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    103679990 (MAPK9)
   05161 Hepatitis B
    103679990 (MAPK9)
   05171 Coronavirus disease - COVID-19
    103679990 (MAPK9)
   05162 Measles
    103679990 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103679990 (MAPK9)
   05169 Epstein-Barr virus infection
    103679990 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103679990 (MAPK9)
   05142 Chagas disease
    103679990 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103679990 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103679990 (MAPK9)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103679990 (MAPK9)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103679990 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 103679990
NCBI-ProteinID: XP_008707741
UniProt: A0A384DL69
LinkDB
Position
Un
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
LDWEERSKNGVVKDQPSDAAVSSNATPSRSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgacagtcagttttacagtgtacaagtggcagactcaaccttc
acggtcctcaaacgttaccagcagttgaagccaatcggctccggagcccaaggaatagtt
tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaatcaaactcatgcaaagagagcttaccgtgaactcgtcctcttaaaatgtgtc
aatcataaaaatataattagtttattaaatgtgtttacaccacaaaagactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcac
atggagttggaccatgaaagaatgtcctaccttctttaccagatgctctgtggtattaaa
catctgcattcagctggtatcattcatagagacttgaaaccgagcaacatcgtggtaaaa
tcagactgcacgcttaagatccttgactttggcctggcccggacagcatgcaccaacttc
atgatgacgccgtacgtggtgacgcgctattaccgggcgcccgaagtcatcctcggcatg
ggctacaaggagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgattttccaaggcactgatcatattgatcagtggaataaagtcattgagcag
ctgggaacgccgtccgcggattttatgaagaaacttcagccgaccgtgaggaattatgta
gaaaacagaccgaagtaccccggcatcaaatttgaagagctcttccccgattggatattc
ccatcagaatccgagcgagacaaaattaaaacaagtcaagccagagatttgttatcgaaa
atgttagtgatagatcccgacaagcgaatctctgtagacgaagctttacgtcacccttat
attaccgtttggtatgaccctgctgaagccgaggcgccaccacctcagatttacgatgcc
cagctggaagaaagagagcatgcaattgaagagtggaaagagctgatttacaaagaagtg
ctggattgggaagaacgaagcaagaacggtgtggtcaaagatcagccttcagatgcagca
gtaagtagcaacgccactccttcccggtcgtcgtccatcaacgacatctcgtccatgtcc
actgagcagacgctggcctcagacacagacagcagcctcgacgcctcgacgggacccctc
gaaggttgccgatga

DBGET integrated database retrieval system