KEGG   Ursus maritimus (polar bear): 103667905Help
Entry
103667905         CDS       T03271                                 

Gene name
OGDHL
Definition
(RefSeq) oxoglutarate dehydrogenase-like
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00020  Citrate cycle (TCA cycle)
umr00310  Lysine degradation
umr00380  Tryptophan metabolism
umr01100  Metabolic pathways
umr01200  Carbon metabolism
Module
umr_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103667905 (OGDHL)
  09105 Amino acid metabolism
   00310 Lysine degradation
    103667905 (OGDHL)
   00380 Tryptophan metabolism
    103667905 (OGDHL)
Enzymes [BR:umr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     103667905 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 103667905
NCBI-ProteinID: XP_008694397
LinkDB All DBs
Position
Un
AA seq 1006 aa AA seqDB search
MSQLRLLPSRLGAQASRLLAPHDIQMFNWRSRSSGPPATFPSGKRGGSSSYMEEMYFAWL
ENPQSVHKYWDSFFRKASEEGACDPTQPRFPESRPAVSSRTETSKLVEDHLAVQSLIRAY
QIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLAFYDLREADLDKEFQLPTTTFIGGS
EHTLSLREIIRRLESTYCQHIGLEFMFINDVEQCQWIRRKFETPGVMQFSSEEKRTLLAR
LVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENVILGMPHRGRLNV
LANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTNRNITLSLVANPSHL
EAVDPVVQGKTKAEQFYRGDAQGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSYTTNGT
VHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEWRNTF
NKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHRQVPVLKKYADKLIAEGTVTLQEFEE
EIAKYDRICEEAYGRSKDKKILHIKHWLDSPWPGFFNVDGEPKSMTCTATGIPEDVLTHI
GEVASSVPVEDFQIHTGLSRILRGRADMTKTRTVDWALAEYMAFGSLLKEGIHVRLSGQD
VERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGYAMASP
NALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSSARPER
FLQMSNDDSDAYPVFTEDFEVSQLYDCNWIVVNCSTPANYFHVLRRQVLLPFRKPLIIFT
PKSLLRHPEAKSSFDQMVSGTSFQRVIPEDGAAAQDSERVRRLIFCTGKVYYDLVKERSS
QGLEEQVAITRLEQISPFPFDLIKREAEKYPGAELVWCQEEHKNMGYYDYISPRFMTILS
RARPIWYVGRDPAAAPATGNRNTHLVSLKKFLDTAFNLQAFEGKTF
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagctgagactgttgccctcccggcttggggcgcaggcctcaaggctcctggcc
ccacatgacatccagatgttcaactggcgcagcaggtcgtcggggccaccggccaccttc
ccaagtggcaaacgtggaggcagctccagttacatggaggagatgtacttcgcctggctg
gaaaacccccagagcgtgcacaagtactgggacagcttcttccgaaaagccagtgaggaa
ggcgcctgtgacccgactcagccacggttccccgagagcaggccagcagtctcgagtcgg
accgagaccagcaagctggtagaggaccacctagctgtgcagtccctgatccgggcctac
cagatccggggccaccatgtggcccagctggaccccctgggcattctggatgcagacctg
gactcctttgtgccctcagacttaatcacaaccatcgataaattggccttctatgacctg
cgggaggctgacctagataaggagttccagctgcccacgaccaccttcatcggggggtct
gaacataccctgtctctgcgggagatcatccggcgcctggagagcacctactgccagcac
atcggcctggagttcatgttcatcaatgatgtggagcagtgccagtggatccggcggaag
ttcgagacgcccggcgtgatgcagttctccagtgaggagaagcggaccctgctggcccgg
ctggtgcgctccatgagatttgaagacttcctggcccggaagtggtcctccgagaagcga
tttggcctggagggctgtgaggtcatgattcccgccctcaagaccatcatcgacaagtcc
agtgagatggggatcgagaatgtcatccttgggatgccacacaggggcaggctgaatgtg
ctggccaacgtgatccgcaaggacctggagcagatcttctgccagtttgaccctaagctg
gaggcggcagacgagggctctggagacgtcaaatatcacctcggcatgtaccatgagagg
atcaaccgggtcaccaacagaaatatcactttgtccctcgtggccaacccttcccacctg
gaagccgtggaccctgtggtgcagggaaagacgaaggcagagcagttctaccgaggggat
gcccagggcaagaaggtcatgtccatcctggttcatggggatgctgccttcgctggccaa
ggtgtggtgtatgagaccttccacctgagtgacctgccctcttacaccaccaatggtact
gtgcatgtggttgtcaacaaccagattggcttcaccacagacccccgcatggcccgctcc
tcgccataccccaccgatgtggcccgtgtggtcaacgcgcctatcttccacgtgaacgca
gatgacccagaggccgtgatatacgtgtgcagtgtggcagccgagtggaggaacacgttc
aataaagatgttgtggtggacttggtctgttaccgccggcgtggccacaatgagatggac
gagcccatgttcacgcagccgctcatgtacaagcagatccacagacaggtgcctgtgctg
aagaagtacgcagacaagctcattgctgagggcacagtcaccctgcaagagttcgaggaa
gaaatcgccaaatatgaccggatctgtgaggaggcatatggcaggtccaaggataaaaag
atcctgcatataaagcactggctggactccccctggcctggcttcttcaatgtggacggg
gagcccaagagcatgacgtgcacagccacaggcattcccgaggacgtcctgacccacatt
ggagaagtggccagctccgtgcccgtggaggacttccagatccacaccggcctctctcga
atcctgcggggccgtgcggacatgaccaagacacggacggtggactgggcactggcagag
tacatggccttcggctccttgctcaaggagggcatccacgtgcggcttagcgggcaggat
gtggagaggggcacgttcagtcaccggcaccacgttctccatgaccaggaagttgaccgg
aggacgtgtgtccccatgaaccacctttggcctgaccaggccccctacactgtgtgcaac
agctccctctcagagtatggagtcctgggctttgagttgggctatgccatggccagcccc
aatgccctggtcctctgggaggctcagttcggtgacttccacaacacggcccagtgcatc
atcgaccagttcatcagcactggccaggccaagtgggtgcggcacaacggcatcgtattg
ctgctgccccacggcatggagggcatgggcccagagcactcctcagcaaggcctgagagg
ttcctgcagatgagcaatgatgactccgacgcctaccccgtgttcacggaggacttcgaa
gtgagccagctctatgactgcaactggatcgtcgtcaactgctccacaccagccaactat
ttccacgtgctgcgccgccaggtcctgctgcccttccgtaagccgctgatcatcttcaca
cccaaatctctgctgagacacccagaggccaagtccagcttcgaccagatggtatccggg
acgagcttccagcgggtgattcctgaggacggggctgcggcacaggattctgagcgggtc
cggcggctcatcttctgcaccggaaaggtgtactatgacctggtgaaggagcggagcagc
cagggcctggaggagcaagtggccatcacgcggctggaacagatctctccattccccttc
gacttgatcaaacgagaggcagagaagtacccaggtgcagagctggtgtggtgccaggaa
gagcacaagaacatgggctactatgactacatcagcccgcgcttcatgaccatcctgagc
cgggcgcggcccatatggtacgttggccgtgacccagcagctgcaccagccacaggaaac
aggaacactcacctggtttctctgaagaagtttctggatactgcctttaatctccaggcc
tttgagggcaagacattttag

DBGET integrated database retrieval system