KEGG   Ursus maritimus (polar bear): 103668004Help
Entry
103668004         CDS       T03271                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00010  Glycolysis / Gluconeogenesis
umr00051  Fructose and mannose metabolism
umr00052  Galactose metabolism
umr00500  Starch and sucrose metabolism
umr00520  Amino sugar and nucleotide sugar metabolism
umr00524  Neomycin, kanamycin and gentamicin biosynthesis
umr01100  Metabolic pathways
umr01200  Carbon metabolism
umr04066  HIF-1 signaling pathway
umr04910  Insulin signaling pathway
umr04930  Type II diabetes mellitus
umr04973  Carbohydrate digestion and absorption
umr05230  Central carbon metabolism in cancer
Module
umr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
umr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103668004 (HK1)
   00051 Fructose and mannose metabolism
    103668004 (HK1)
   00052 Galactose metabolism
    103668004 (HK1)
   00500 Starch and sucrose metabolism
    103668004 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    103668004 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103668004 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    103668004 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103668004 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103668004 (HK1)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    103668004 (HK1)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103668004 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103668004 (HK1)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103668004 (HK1)
Membrane trafficking [BR:umr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103668004 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 103668004
NCBI-ProteinID: XP_008694508
UniProt: A0A384CI39
LinkDB All DBs
Position
Un
AA seq 915 aa AA seqDB search
MVLGFEPRVAGSGTLVLDLCDTAICLRIDKYLYAMRLSDETLIDIMTRFKKEMKNGLSRD
FNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEQNQNVHMESEIYDT
PENIVHGSGSQLFDHVAECLGDFMEKKKIKDKKLPVGFTFSFPCRQSKIDEGILITWTKK
FKASGVEGMDVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGT
NACYMEELRHIDLVEGDEGRMCVNTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFE
KMVSGMYLGELVRLILVKMAKESLLFEGRITPELLTRGKFKTSDVSAIEKNKEGLHNAKE
ILTRLGVEPSDDDCISVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDG
SLYKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGRGQGARLAEQHRQIEETLAHFRLTKD
MLLEVKKRMRAEMDMGLRKQTHEKAVVKMLPSFVRSTPDGTEHGDFLALDLGGTNFRVLL
VKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPKMPLGFTF
SFPCKQTSLDAGILITWTKGFKATDCVGHDVATLLREAIKRREEFDLDVVAVVNDTVGTM
MTCAYEEPTCEVGLIVGTGSNACYMEEMKNVETLEGNDGRMCINMEWGAFGDNGCLDDIR
TLYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIF
QTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAAVV
DKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMYQTVKELSPKCNVSFLLSEDGSGKGAA
LITAVGVRLREETSS
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgggatttgagccccgcgtggctggctctggcacccttgttcttgacctctgc
gacactgccatctgtctgaggattgacaagtatctctatgccatgcggctctctgatgaa
accctgatagatatcatgactcgtttcaagaaggagatgaagaatggcctctcccgggat
tttaatccaacagccacagtcaagatgttgccaacgtttgtaaggtccattcctgatggt
tcagaaaagggagatttcattgccctggatcttggcgggtcttcctttcgaattctgagg
gtacaagtgaatcacgagcaaaaccagaatgttcacatggagtccgagatttatgacacc
ccggagaacatcgtgcatggcagtggaagccagctttttgatcacgtggccgagtgcctg
ggagacttcatggagaaaaaaaaaatcaaggacaagaaattacctgtgggattcacgttt
tctttcccctgtcggcagtccaaaatagacgagggcatcctgataacctggacaaagaaa
tttaaagcgagcggagtggagggaatggatgtggtgaagttgcttaacaaagccattaag
aagcgcggggactacgacgccaacattgtggccgtggtgaacgacacggtggggaccatg
atgacctgtggctacgatgaccagcagtgtgaagtcggcctcatcatcggcaccggcacc
aacgcctgctacatggaggagctgaggcacattgacctggtggagggcgatgaggggagg
atgtgcgtcaacacggagtggggggccttcggcgacgacgggtccctggaagacatccgc
accgagttcgaccgggagatagaccgtggctctctcaaccccgggaagcagctgtttgag
aagatggtcagtggcatgtacttgggggagctggtgcgactgatcctggtcaagatggcc
aaggagagcctcttgtttgaagggcggatcaccccggagctgctcaccagggggaagttc
aagaccagcgacgtgtcagccattgagaagaataaggaaggcctccacaatgccaaagaa
atcctgacccgcctgggagtggagccatccgatgacgactgtatttcagtccagcacgtg
tgtaccattgtctcatttcgctcggccaacctggtggctgcaacgctgggcgccatcttg
aaccgccttcgagataacaagggcacacccaggctgcggaccacggttggtgtcgacggg
tctctttacaagacgcacccacagtattcccggcgtttccacaagactctgaggcgcttg
gtgcccgactccgatgtgcgcttcctcctctcggagagcggcaggggccagggggcccgc
ctggcggagcagcaccggcagatagaggagaccctggcccacttccgcctcaccaaggac
atgctgctggaggtgaagaagaggatgcgggccgagatggatatgggcctgaggaagcag
acacacgagaaggccgtggtcaagatgctgccctcctttgtccggagcactccagacggg
accgagcatggtgacttcttggcccttgatcttggaggaacaaatttccgtgtcctgctg
gtgaaaatccgcagtgggaaaaagagaacggtggaaatgcacaacaagatctatgccatt
cccattgaaatcatgcagggcactggggaagagctgtttgaccacatcgtctcctgcatc
tctgacttcctggactacatggggatcaaaggccccaaaatgcctctgggcttcacgttc
tccttcccctgcaagcagacgagcctggatgcgggaatcttgatcacctggaccaagggt
tttaaggcaaccgactgcgtggggcacgacgtagcaaccttactaagggaagcgataaaa
cggagagaggaattcgacctggacgtggtggctgtggtcaatgacacggtgggcaccatg
atgacctgtgcttacgaggagcctacctgcgaggttggactcattgtagggaccggcagc
aacgcctgctacatggaggaaatgaagaatgtcgagacgctggaggggaatgacgggcgc
atgtgtatcaacatggagtggggtgcctttggggacaacgggtgtctagatgatatcaga
acactctatgacagactggtggatgaatattctctaaacgctgggaaacaaaggtacgag
aagatgattagcggtatgtacctgggtgagatcgtccgcaacatcttgatcgacttcacc
aagaagggcttcctcttccgagggcagatctctgagacgctgaagacccggggcatcttt
cagaccaaatacctttcccagattgagagtgaccgattagcgctgctccaggtccgggcc
atcctccagcagctgggcctgaacagcacctgtgacgacagtatcctggtcaagactgtg
tgcggggtggtgtccaagagggccgcgcagctgtgtggtgcgggcatggctgccgtggtg
gataagatccgagagaacagagggctggaccacctcaacgtgactgtgggggtggacgga
acactctacaagcttcatccgcacttctccagaatcatgtaccaaaccgtgaaggaactg
tcaccaaaatgtaacgtgtccttcctcctgtccgaagacggtagcggcaagggggccgcc
ctcatcacggcggtgggcgtccggctccgggaagagacgagcagctaa

DBGET integrated database retrieval system