KEGG   Ursus maritimus (polar bear): 103668407
Entry
103668407         CDS       T03271                                 

Gene name
TPM3
Definition
(RefSeq) tropomyosin 3
  KO
K09290  tropomyosin 3
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04260  Cardiac muscle contraction
umr04261  Adrenergic signaling in cardiomyocytes
umr05200  Pathways in cancer
umr05216  Thyroid cancer
umr05410  Hypertrophic cardiomyopathy
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103668407 (TPM3)
   04261 Adrenergic signaling in cardiomyocytes
    103668407 (TPM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103668407 (TPM3)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103668407 (TPM3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103668407 (TPM3)
   05414 Dilated cardiomyopathy
    103668407 (TPM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:umr04812]
    103668407 (TPM3)
Cytoskeleton proteins [BR:umr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     103668407 (TPM3)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II TMF_DNA_bd CENP-F_leu_zip DUF745 Crescentin BORCS7 ADIP CLZ
Other DBs
NCBI-GeneID: 103668407
NCBI-ProteinID: XP_008694846
UniProt: A0A384CJ11
LinkDB
Position
Un
AA seq 224 aa
MGGAQPQLDLRRTRGELGARAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTE
ERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKYEEEIKILTDKLKEAETRAE
FAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQTLLDLNEM
NT seq 675 nt   +upstreamnt  +downstreamnt
atgggtggggctcagccgcagttggacctgaggcggacgaggggggaactgggtgctcgg
gctgaggctgaagtggcctccttgaaccgtaggatccagctggttgaagaggagctggac
cgtgcccaggagcgcctggccactgccctgcaaaagctggaggaagcggagaaagctgct
gatgagagcgagagaggtatgaaggttattgagaaccgagccttaaaagatgaagaaaag
atggaactccaggaaatccaactcaaagaggccaagcacattgcagaagaggcagatcgg
aagtatgaagaggtggcacggaagttggtgattattgagggggacttggaacgcacagag
gaacgagctgagctggcagagtcccgttgccgggagatggatgagcagatcagactgatg
gaccagaacctgaagtgtctgagtgctgctgaagaaaagtactctcaaaaggaagacaaa
tacgaggaagagataaagattctcacggataaactcaaggaggcagagacccgtgctgag
tttgctgagagatcggtagccaagctggagaagacaattgatgatttggaagataagctg
aaatgcaccaaagaggagcacctctgtacacaaaggatgctggaccagactctgcttgac
ctgaatgagatgtag

KEGG   Ursus maritimus (polar bear): 103668718
Entry
103668718         CDS       T03271                                 

Definition
(RefSeq) tropomyosin alpha-3 chain-like
  KO
K09290  tropomyosin 3
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04260  Cardiac muscle contraction
umr04261  Adrenergic signaling in cardiomyocytes
umr05200  Pathways in cancer
umr05216  Thyroid cancer
umr05410  Hypertrophic cardiomyopathy
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103668718
   04261 Adrenergic signaling in cardiomyocytes
    103668718
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103668718
  09162 Cancer: specific types
   05216 Thyroid cancer
    103668718
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103668718
   05414 Dilated cardiomyopathy
    103668718
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:umr04812]
    103668718
Cytoskeleton proteins [BR:umr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     103668718
SSDB
Motif
Pfam: Tropomyosin_1 Tropomyosin CLZ Laminin_I DUF5828 DUF3829 ERM MAD HrpB7 NBP1 Allexi_40kDa DUF4200 DUF812 RNase_Y_N Atg14 DUF2514 AAA_13 Sod_Fe_N PHM7_cyt TP53IP5 Golgin_A5 Fmp27_WPPW
Other DBs
NCBI-GeneID: 103668718
NCBI-ProteinID: XP_008695244
UniProt: A0A384CL89
LinkDB
Position
Un
AA seq 148 aa
MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTEDELDK
YSEALKDAQEKLELAEKKAADVSIREMEEGLSTHTQRHVNTTQFQTRLDTDILVDSQSLS
LPVSKCLQRSAGEQEVGEEGCEQEAKIP
NT seq 447 nt   +upstreamnt  +downstreamnt
atgatggaggccatcaagaaaaagatgcagatgctgaagctggacaaggagaatgctctg
gaccgggcagagcaagccgaagcagagcagaagcaggcggaagaacgaagtaaacagctg
gaagatgagctggcagccatgcagaagaagctgaaagggacggaggatgagcttgacaag
tattctgaagctctgaaggacgcccaggagaagctggagctggctgagaagaaggctgct
gatgtgagtattagagagatggaagagggtttatccacacacacacagcgccatgttaat
acgactcaattccaaacacgcttggacacagacatacttgtggattcacagagtctttcc
ttaccagtcagtaagtgccttcagaggagtgctggagaacaagaagtgggagaggaaggc
tgtgagcaggaggcaaaaatcccttaa

KEGG   Ursus maritimus (polar bear): 103669375
Entry
103669375         CDS       T03271                                 

Gene name
TPR
Definition
(RefSeq) translocated promoter region, nuclear basket protein
  KO
K09291  nucleoprotein TPR
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr03013  RNA transport
umr05014  Amyotrophic lateral sclerosis
umr05200  Pathways in cancer
umr05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    103669375 (TPR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103669375 (TPR)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103669375 (TPR)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103669375 (TPR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:umr03019]
    103669375 (TPR)
Messenger RNA biogenesis [BR:umr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     103669375 (TPR)
SSDB
Motif
Pfam: TPR_MLP1_2 Seryl_tRNA_N DUF5082 DUF1192 Imm70
Other DBs
NCBI-GeneID: 103669375
NCBI-ProteinID: XP_008695935
UniProt: A0A384CNA3
LinkDB
Position
Un
AA seq 2324 aa
MASRSFDEQQYFEIEKRLSHSQERLVNETRECQSLRLDLEKLNNQLKALTEKNKELEVAQ
DRSVAIQSQFTRTKEELEAEKRDLVRTNERLSQELEYLTEDFKRQNEKLKESNATKGDLQ
LKLDELQASDVSVKYREKRLEQEKELLHNQNTWLNTELKTKTDELLALGREKGNEILELK
CNLENKKEEVSRMEEQMNGLKTSNENLQKHVEELLTKLKEAKEQQASMEEKFHNELNAHI
KLSNLYKSAADDSEAKSNELTRAVDELHKLLKEAGEANKAIQDHLLEVEESKDQMKKEML
EKIGKLEKELENANDLLSATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYV
ETQDQLLLEKLENKRINKYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMK
EIQRLQEDTDKANKHSSVLERDNQRMEVQIKDLSQQIRVLLMELEEARGNHVIRDEEVSS
ADISSSSEVISQHLVSYRNIEELQQQNQRLLVALRELGETREREEQETTSSKIAELQLKL
ENALTELEQLRESRQHQMQLVDSIVRQRDMYRILLSQTTGVAIPLQASSLDDISLASTPK
RSSTSQTASTPAPVPVIESAEAIEAKAALKQLQEIFENYKKEKADNEKIQNEQLEKLQDQ
ITDLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLHERNQKLTATTQKQEQIINTM
TQDLRGANEKLAVAEVRAENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTNLQTIQ
GILERSETETKQRLSSQIEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTE
TNLHLNTKELLKNAQKEIATLKQHLSNMEVQLASQSSQRTGKGQPTNKEDVDDLLSQLRQ
AEEQVNDLKERLKTSTSNVEQYRAMVTSLEESLNKEKQVTEEVRKNIEVRLKESAEFQTQ
LEKKLMEVEKEKQELQDDKRKAIESMEQQLSELKKTLNSVQNEVQEALQRASTALSNEQQ
ARRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQKAESQ
LLECKASWEERERMLKDEVSKCMSRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLN
VSLNEEGKSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLN
AEREKVQVTAKTMAQHEELMKKTETMNVVMETNKMLREEKERLEQDLQQMQAKVRKLELD
ILPLQEANAELSEKSGMLQAEKKLLEEDVKRWKARNQHLVSQQKDPDTEEYRKLLSEKEV
HTKRIQQLTEEIGRLKAEIARSNASLTNNQNLIQSLKEDLNKVRTEKETIQKDLDAKIID
IQEKVKTITQVKKIGRRYKTQYEELKAQQDKVMETSAQSSGDHQEQHVSVQEMQELKETL
NQAETKAKSLESQIENLQKTLSEKEAEARNLQEQTVQLQSELSRLRQDLQDRTTQEEQLR
QQITEKEEKTRKAIVAAKSKIAHLAGVKDQLTKENEELKQRNGALDQQKDELDVRMTALK
SQYEGRISRLERELREHQERHLEQRDEPQEPTNKVPEQQRQITLKTTPASGERGIASTSD
PPTANIKPTPVVSTPSKVTAAAMAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQV
ESQEAMQSEGPVEHVPVFGSTSGSVRSTSPNVQPSIPQPILTVQQQTQATAFVQPTQQSH
PQIEPANQELSPNIVEVVQSSPVERPSTSTAVFGTVSATPSSSLPKRTREEEEDSTIEAS
DQVSDDTVEMPLPKKLKSVTPVGTEEEVMAEESTDGEVETQVYNQDSQDSIGEGVTQGDY
TPMEDSEETSQSLQIDLGPLQSDQQTTTSSQDGQGKGDDVIVIDSDDEEEDDDENDGEHE
DYEEDEEDDDDDEDDTGMGDEGEDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESMG
GGESNQRAADSQNSGEGNTGTAESSFSQDISREQQPSSASERQTPRAPQSPRRPPHPLPP
RLTIHAPPQELGPPVQRIQMTRRQSVGRGLQLTPGIGGMQQHFFDDEDRTVPSTPTLVVP
HRTDGFAEAIHSPQVAGVPRFRFGPPEDMPQTSSSHSDLGQLASQGELSLGLGMYETPLF
LAHEEESGGRSVPTTPLQVAAPVTVFTESTTSDASEHASQSVPMVTTSTGTLSTTNETAT
GDDGDEVFVEAESEGISSEAGLEIDSQQEEEPVQASDESDLPSTSQDPPSSSSVDTSSSQ
PKPFRRVRLQTTLRQGVRGRQFNRQRGVSHAMGGRGGINRGNIN
NT seq 6975 nt   +upstreamnt  +downstreamnt
atggcatcccggagctttgacgaacaacagtattttgagatagagaagaggctgtcccac
agtcaggagagacttgtgaatgaaacccgagagtgccaaagtttgaggcttgacctagag
aagctcaacaatcaactgaaggcactaactgagaaaaataaagaacttgaagttgctcag
gatcgcagtgttgccattcagagtcagtttacaaggacgaaagaagaattagaagctgag
aaaagagacttagttagaaccaatgagagactatctcaagaacttgaatatttaacagag
gattttaaacgtcaaaatgaaaaacttaaagaaagcaatgccacaaagggtgatctgcag
ttaaaactggatgaacttcaagcttctgatgtttctgttaaatatcgagaaaaacgcttg
gagcaagaaaaggagttgttacataatcagaatacatggctgaatacagagttaaaaact
aaaaccgatgaacttctggctcttggcagagaaaaaggaaatgagattctagagcttaaa
tgtaatcttgaaaacaaaaaagaggaggtttctagaatggaagaacagatgaatggcttg
aaaacatcaaatgagaatcttcaaaaacatgtagaagagctgttgaccaaactgaaagag
gccaaggaacagcaggccagtatggaagagaaattccacaatgaattaaatgctcatata
aagctctctaatctatacaagagtgctgccgatgactcagaagcaaagagcaatgaactg
acccgagcagtggatgaactacacaaacttttgaaagaagctggagaagccaataaagca
atacaggatcatcttttagaagtggaggaatctaaagaccaaatgaaaaaagaaatgctt
gagaaaatagggaaattggagaaggaattagagaacgcaaatgacctgctttctgccaca
aaacgtaaaggagccatattatctgaagaagagcttgcagctatgtctcctactgcagca
gctgtagctaagatagtgaagcccggcatgaaattaaccgagctgtataatgcttatgtg
gaaactcaggatcagttgcttttggagaaactagagaataaaagaattaataagtatcta
gatgaaatagtgaaagaagttgaagccaaagcaccaattttgaaacgccagcgtgaggag
tatgaacgtgcacagaaagctgtggcaagtttatctgttaagcttgaacaagctatgaag
gagattcagcgattgcaggaggacactgataaagctaacaaacattcatctgtgcttgaa
agagacaatcaaaggatggaagtacaaataaaagatctttcacaacagattagagtgctt
ttgatggaacttgaagaagcaaggggtaatcatgtaattcgtgatgaagaagtaagctct
gctgatataagtagttcatctgaagtaatatcacagcatctagtatcttatagaaatatt
gaagaacttcaacagcaaaatcagcgtctcttagtggcccttagggaacttggggaaacc
agagaaagagaagaacaagaaacaacttcatctaaaattgctgagcttcagctaaaactt
gagaatgccctcactgaattagaacaactccgtgagtcacgacaacatcaaatgcagctt
gttgattccatagttcgtcagcgtgacatgtaccgtattttgttgtcgcaaacaacagga
gttgccattcctttacaagcttcaagcttagatgatatttctcttgcatcaactccaaaa
cgttcaagtacatcccagactgcttccactcctgctccagtacctgtaattgagtcagca
gaggccatagaagccaaggctgcccttaaacagttgcaggaaatttttgagaattacaaa
aaagaaaaggcagataatgaaaaaatacaaaatgagcaacttgagaaacttcaggatcaa
attacagatttacgatcacaaaacaccaaaatttctacacaactggacttcgcttctaaa
cgttacgaaatgctgcaagataatgttgaaggatatcgtcgagaaatcacatccctacat
gagagaaatcagaaactcactgcaacaactcaaaagcaggaacagatcatcaatacaatg
acgcaggatttgagaggagcaaatgaaaagctagctgttgcggaagtaagagcagaaaac
ttgaaaaaggaaaaggaaatgcttaaattgtcagaagtccgtctttctcagcaaagggag
tctttattagctgaacaaagagggcaaaacttgctgctcactaatctgcaaacaattcag
ggaatattagagcgatctgaaacagaaaccaaacaaagacttagtagccagatagaaaaa
ctggaacatgagatatctcatctaaagaagaagctggaaaatgaggtggaacaaaggcat
acactcactagaaatctagatgttcaacttttagatacaaagagacagctggatactgag
acaaatcttcatcttaacacaaaagaactattaaaaaatgctcaaaaggaaattgctaca
ttgaaacagcacctcagtaatatggaagtccagcttgcctctcagtcctcacagagaact
ggtaaaggtcagcccaccaacaaagaagatgtggatgatcttctaagtcagctaaggcag
gcagaggagcaggtgaatgatttaaaggagagactcaaaacaagtactagtaatgtggaa
caatatcgagcaatggttactagtttagaagaatctcttaacaaggaaaaacaggtgaca
gaagaagtacgtaagaatattgaagttcgtttaaaagagtcagcggaatttcagacacag
ttggaaaagaagttgatggaagttgagaaggaaaaacaggaacttcaggatgacaagaga
aaggccatagagagcatggaacaacagttatctgagttaaagaaaacactcaacagcgtt
cagaacgaagtacaagaagctcttcagagagcaagcacagctttgagtaatgaacagcaa
gccagacgtgactgtcaggaacaggctaaaatagctgtggaagctcagaataagtatgag
agagaactgatgctacatgctgctgatgttgaagctctacaagctgccaaggaacaggtt
tccaaaatggcatcagtccgtcagcatttggaagaaacaacccagaaagcagaatcacag
ttactggagtgtaaagcatcttgggaggaaagagagagaatgttaaaggatgaagtttcc
aagtgtatgtctcgctgtgaagatctggagaaacagaacagattacttcatgatcagatt
gaaaaattaagtgacaaggttgtcgcctctgtgaaggaaggtgtacaaggtcccttgaat
gtatctcttaatgaagaaggaaaatctcaagaacaaattctagaaattctcagatttata
cgacgagaaaaagaaatcgctgaaaccaggtttgaggtggctcaggttgagagtctgcgt
tatcgacaaagagttgagcttttagaaagagaactgcaggaactgcaggatagtctgaat
gctgaaagagagaaagtccaggtcactgcaaaaacaatggctcagcatgaagaactgatg
aagaaaactgaaacaatgaatgtagtgatggagaccaataagatgctaagagaagagaaa
gagaggctggaacaggatctacagcagatgcaagcaaaggtaaggaaactggagttagat
attttacccttacaagaagcaaatgctgagctaagtgaaaaaagcggtatgttgcaagca
gagaagaagttactagaagaagatgtcaaacgttggaaagcacggaaccagcatctagta
agtcaacagaaagatccagatacagaagaatatcggaagctcctttctgaaaaggaagtt
catactaagcgtattcaacagttgactgaagaaattgggagacttaaagctgagattgca
agatcaaatgcatctttgaccaacaatcagaacttaatccagagtctaaaggaagactta
aataaagtaagaactgaaaaggaaaccattcaaaaggacttagatgccaaaataattgat
atccaagagaaggtcaaaactattactcaagtcaagaagattgggcgtaggtacaagact
caatatgaagaacttaaagcacaacaggataaggtcatggagacctcggctcagtcttct
ggagaccaccaggaacagcatgtctcagtccaggaaatgcaggagctcaaagaaaccctc
aatcaagctgaaacaaaggcaaaatcactagagagtcaaatagaaaatctgcagaagaca
ttatccgaaaaagaggcagaagcaagaaatctgcaggaacaaactgtgcagcttcagtct
gagctttcccgacttcgtcaggatcttcaagatagaaccacacaagaggagcagctccga
cagcagataaccgaaaaggaagaaaaaacaagaaaggccatagtagcagcaaagtcaaag
attgcacatctagctggtgtaaaagatcagctaactaaagaaaatgaggagcttaaacaa
aggaatggagccttagatcagcagaaagatgaattggatgttcgaatgactgctcttaaa
tcccagtatgaaggtcgaattagtcgcttggaaagagaactcagagagcatcaagagaga
caccttgagcagagagatgagcctcaagaacctactaataaggtcccagaacagcagaga
cagatcacattgaaaacaactccagcttctggtgaaagaggaattgccagcacatcagac
ccaccaacagccaatatcaaaccaactcctgttgtgtctactccaagtaaagtgacagct
gcagctatggctgggaataagtcaacacccagagctagtatccgcccaatggtcacacct
gcaactgttacaaatcctactactaccccaacagctacagtgatgcccactacacaagta
gaatcacaggaagctatgcagtcagaagggcctgtggaacatgttccagtttttggaagc
acaagtggttctgtccgctctactagtcctaacgtccagccttctatccctcaacccatt
ttaactgttcagcaacaaacacaggctacagcttttgtgcagcccacccaacagagtcat
cctcagattgagcctgcaaatcaagagctgtcccccaacatagtagaagttgtacagagt
tctccagttgaacggccttctacttccacagcagtatttggcactgtgtcagctacccca
agttcttctttgcctaaacggacacgtgaagaggaagaggatagcaccatagaagcatca
gaccaagtctctgatgatacagtagaaatgcctcttccaaagaagttgaaaagtgttacc
cctgtaggaactgaggaagaagttatggcagaagaaagtactgatggagaggtagaaact
caagtatacaaccaagattctcaagattccattggagaaggagttacccagggagattat
actccaatggaagacagtgaagaaacctctcagtctctacaaatagaccttggacccctt
cagtcagatcagcaaacaacaacttcgtcccaagatggtcagggcaaaggagatgatgtc
attgtgattgacagtgatgatgaagaagaggatgatgatgaaaatgatggagaacatgag
gattatgaggaagatgaggaagatgatgacgatgatgaagatgacacagggatgggagac
gagggtgaggacagtaacgaaggcactggtagtgcagatggcaatgatggctatgaagct
gatgatgctgagggtggtgatgggactgatccaggtacagaaacagaagaaagtatgggt
ggaggtgaaagtaatcagagagctgctgattctcaaaacagtggtgaaggtaatacaggt
actgcagagtcctctttctcccaggacatttctagagaacagcagccatcatcagcatct
gaaagacagactcctcgagcacctcagtctccaagacgccctccacaccctcttcctcca
cgactgaccattcatgctccacctcaagaattgggaccaccagttcagagaattcagatg
actcggaggcagtctgtaggacggggacttcagttgactccaggaatcggtggcatgcag
cagcatttttttgatgatgaagacagaacagttccaagtactccaactcttgtggtgccg
catcgtactgatggatttgctgaagcaattcattccccacaggttgctggtgttcctaga
ttccggtttgggccacctgaagatatgccacaaacaagttcaagtcactctgatcttggc
cagcttgcttctcaaggagaattgtctttaggtttaggaatgtatgaaacacccctcttc
ctagctcatgaagaagagtcaggtggccgaagtgttcccactacccctctacaagtagca
gccccagtgactgtgtttactgagagtaccacctctgatgcttcggagcatgcctctcag
tctgttccaatggtgacaacatccactggcactttatccacaacaaatgaaacagcaaca
ggtgatgatggagatgaagtatttgtggaggcagaatctgaaggtattagttcagaagca
ggcctagaaattgatagccagcaggaagaagaacctgttcaggcatctgatgagtcagat
cttccttctaccagccaggatcctccgtccagctcttctgtagatactagcagtagtcaa
ccaaagcctttcagacgagtcagacttcagacaacattgagacaaggtgtccgtggtcgt
cagtttaacagacagagaggtgtgagccatgcaatgggagggagaggaggaataaataga
ggaaatattaattaa

KEGG   Ursus maritimus (polar bear): 103673261
Entry
103673261         CDS       T03271                                 

Gene name
TFG
Definition
(RefSeq) TRK-fused gene
  KO
K09292  protein TFG
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr05200  Pathways in cancer
umr05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103673261 (TFG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103673261 (TFG)
SSDB
Motif
Pfam: PB1
Other DBs
NCBI-GeneID: 103673261
NCBI-ProteinID: XP_008700238
UniProt: A0A384CZL3
LinkDB
Position
Un
AA seq 401 aa
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLL
DSLEPPGEPGPSASIPENDTVDGRDEKPAASDSSGKQSTQVMAASMSAFDPLKNQDEINK
NVMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQS
EGQMYQQYPQQAAYGAQQPQAPPQPPQQYGIQYSAGYSQQTGPQQPQQFQGYGQQPASQA
PAPAFAGQPQQLPAQPAQQYQASSYPPQTYTTQTSQPTSYSVAPASQPGMAPSQPGAYQP
RPGFTPPPGSTMTPPPSGPNPYARTRPPFGQGYTQPGPGYR
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgaacggacagttggacctaagtgggaagctaatcatcaaagctcaacttggggaggat
attcgacggattcccattcataatgaagatattacttatgatgaattagtgctaatgatg
cagcgagttttcagaggaaaactcctgagtaatgatgaagttacaataaagtataaagat
gaagatggagatcttataacaatttttgatagttctgacctttcttttgcaattcagtgt
agtaggatactgaaactgacattatttgttaatggccaaccaagaccccttgaatcgagt
caagtgaagtatctccgtcgagagctgatagaactgcgaaataaagtgaatcgcttgttg
gatagcttggaaccacctggagaaccaggaccttccgccagtattcctgaaaatgatact
gtcgatggtagggatgaaaagcctgctgcttctgattcttctggaaaacagtctactcag
gttatggcagcaagtatgtcagcttttgatcctttaaaaaaccaagatgaaatcaataaa
aatgtcatgtcagcgtttggcttaacagatgatcaggtttcagggccacccagtgctcct
gcagaagaccgttcaggaacacctgacagcattgcttcctcctcctctgctgctcatcca
ccaggagttcagccccagcagccaccatatacaggagctcagacacaagcaggtcagagt
gaaggtcagatgtaccagcagtacccgcaacaggctgcctacggtgcccagcagccacag
gcgccccctcagccgccccagcagtacggtattcagtattcagcaggctatagtcagcag
actggaccccaacaacctcagcagttccagggatatggccagcaaccggcttcccaggca
ccggctcctgcctttgctggccagcctcagcagctgcccgctcaaccagcacagcagtac
caggcgagcagttaccctccacaaacttacactacccagacttctcagcctaccagttat
tctgtggctcctgcctcacaacctggaatggctccaagccagcccggggcctatcaacca
agaccaggttttactccacctcctggaagtactatgactccgcctcctagtgggcctaac
ccttatgctcgcactcggcctccctttggtcagggctatacccaacctggacctggctat
cggtaa

DBGET integrated database retrieval system