KEGG   Ursus maritimus (polar bear): 103668648Help
Entry
103668648         CDS       T03271                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00590  Arachidonic acid metabolism
umr01100  Metabolic pathways
umr04064  NF-kappa B signaling pathway
umr04370  VEGF signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04657  IL-17 signaling pathway
umr04668  TNF signaling pathway
umr04723  Retrograde endocannabinoid signaling
umr04726  Serotonergic synapse
umr04913  Ovarian steroidogenesis
umr04921  Oxytocin signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr05140  Leishmaniasis
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05200  Pathways in cancer
umr05204  Chemical carcinogenesis
umr05206  MicroRNAs in cancer
umr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103668648 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    103668648 (PTGS2)
   04064 NF-kappa B signaling pathway
    103668648 (PTGS2)
   04668 TNF signaling pathway
    103668648 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103668648 (PTGS2)
   04657 IL-17 signaling pathway
    103668648 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    103668648 (PTGS2)
   04913 Ovarian steroidogenesis
    103668648 (PTGS2)
   04921 Oxytocin signaling pathway
    103668648 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    103668648 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    103668648 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    103668648 (PTGS2)
   05206 MicroRNAs in cancer
    103668648 (PTGS2)
   05204 Chemical carcinogenesis
    103668648 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    103668648 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    103668648 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103668648 (PTGS2)
   05165 Human papillomavirus infection
    103668648 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    103668648 (PTGS2)
Enzymes [BR:umr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103668648 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 103668648
NCBI-ProteinID: XP_008695171
UniProt: A0A384CJZ0
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MLARALLLCAALALCRAANPCCSNPCENQGVCMSIGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGVWNIVNNIPFLRNAIMKYVLTSRSHLIESPPTYNVDY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHVYGETLDRQHKLRLFKDGKMKY
QVIDGEVYPPTVKDTQVEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTLQIDDQEYNFQQFVYNNSILLEHGLTQFVESFSRQIAGRV
AGGRNVPAAVQQVAKASIDQSRQMKYQSLNEYRKRFRLKPYASFEELTGEKEMAAGLEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVEMGAPFSLKGLMGNPICSPDYWKPSTFGGEV
GFKIINTASIRSLICNNVKGCPFTAFSVQDPQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcccgcgccctgctgctctgcgccgccctggcgctctgccgtgcagcaaatcct
tgctgttccaacccatgtgaaaaccaaggtgtatgtatgagcataggatttgaccagtat
aagtgtgactgcactcgaacaggattctatggcgaaaactgttcaacacctgaatttctg
acaagaataaaattattcctgaaacccactccaaatacagtgcactacatacttacccac
ttcaagggagtctggaacattgtcaataacattcccttcctgagaaatgcaattatgaaa
tacgtgttgacatcgaggtcacatttgattgagagtccaccaacttacaacgtggactat
ggctataaaagctgggaagccttttctaatctctcctactataccagagctcttccccct
gtggctgatgactgcccaacacccatgggtgtgaaaggcaagaaagagcttcctgattca
aaagagattgtggaaaaatttcttctaagaagaaagttcattcctgatccccagggcaca
aatatgatgtttgcattctttgcccagcacttcacccatcaatttttcaagacagatcat
aagcgagggccagctttcaccaaaggactgggccatggggtggacttaaaccatgtttat
ggggaaactttggatagacaacataaactgcgccttttcaaggatggaaaaatgaaatat
caggtcattgatggagaggtgtatcctcccacagtcaaagatactcaggtggagatgatc
tacccaccccatgttcctgaacacctacggtttgccgtgggccaggaagttttcgggctg
gtgcctggtctgatgatgtatgccacaatttggttgcgggaacataacagagtgtgtgat
gtgcttaaacaggagcacccagagtgggatgatgagcggctgttccagaccagcaggctc
atactgataggagaaaccattaagattgtgattgaagactatgtacagcacttgagtggt
tatcacttcaagctgaagtttgacccagagctgcttttcaaccaacaattccagtaccaa
aaccgtattgctgctgagtttaacacactctaccactggcatccccttctacctgacacc
ttgcaaatagatgaccaggagtacaatttccaacagtttgtctacaacaactctatattg
ctggaacatggacttacccagtttgtggaatcattcagcaggcaaattgctggcagggtt
gccggtggtaggaatgttccagctgcagtacaacaagtagcaaaggcctcaatcgaccag
agcagacagatgaaataccagtctcttaacgagtatcgcaaacgctttcggctgaagccc
tatgcatcattcgaagaacttacaggagagaaggaaatggctgcggggttagaggccctt
tatggtgatattgatgccatggagctgtatcctgccctcctggtagaaaagcctcgtcca
gatgccatctttggtgagactatggtagaaatgggagcacccttttccttgaaaggactt
atgggtaatcccatctgttcgcctgactactggaagcctagcacttttggtggagaagta
ggctttaaaatcatcaacactgcctcaattcggtctcttatctgcaataatgtgaagggc
tgtccttttactgcgttcagtgttcaagacccacagctcaccaaaacagtcaccattaat
gcaagctcttcacactcgggactagatgacatcaatcccacagtccttctaaaagaacgg
tccactgaactgtag

DBGET integrated database retrieval system