KEGG   Ursus maritimus (polar bear): 103669004Help
Entry
103669004         CDS       T03271                                 

Definition
(RefSeq) cationic trypsin
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04080  Neuroactive ligand-receptor interaction
umr04972  Pancreatic secretion
umr04974  Protein digestion and absorption
umr05164  Influenza A
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103669004
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    103669004
   04974 Protein digestion and absorption
    103669004
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    103669004
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:umr01002]
    103669004
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103669004
Enzymes [BR:umr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     103669004
Peptidases [BR:umr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103669004
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103669004
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 103669004
NCBI-ProteinID: XP_008695542
UniProt: A0A384CL32
LinkDB All DBs
Position
Un
AA seq 246 aa AA seqDB search
MKTFIFLALLGATVAFPIDDDDKIVGGYTCQRNSVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSRIQVRLGEYNIAVSEGGEQFINSAKVIRHPNYNSNTIDNDIMLIKLSSPATLN
SRVTAISLPTSCAAAGTQCLISGWGNTQSTGEYYPDVLQCLQAPILSDSSCRNAYPGRIT
SNMICLGYLQGGKDSCQGDSGGPVVCNGVLQGIVSWGAGCAQKGKPGVYTKVCNYVSWIQ
QTIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttcatcttccttgccctgctgggagccactgttgctttccccattgatgat
gatgacaagatcgttgggggatacacctgtcagaggaattctgtcccttaccaggtgtcc
ctgaactcaggctaccacttctgtggcggctccctcatcaattcccagtgggtggtatcc
gcggctcattgctacaagtcccgaatccaggtgcgtctgggagaatacaacatcgcagtc
tctgagggtggcgagcaattcatcaattcggccaaggtcatccgccaccccaattacaac
tcaaatactattgataatgacatcatgctgattaaactgagctcacccgccaccctcaac
tctcgagtgactgctatctctctgccaacatcctgtgcggctgctggtacccagtgcctc
atctctggctgggggaatacccagagcaccggggaatattaccctgatgtcctgcagtgt
cttcaagcccccatcctctctgacagcagttgccgcaatgcctaccctggcaggatcacc
agcaacatgatctgtctgggctacctgcagggtggaaaggactcttgccagggtgactct
ggtgggcctgtggtctgcaacggagtgctccagggcattgtctcctggggtgctggctgt
gctcaaaaagggaagcctggtgtctacaccaaggtctgcaactacgtgagctggattcag
cagaccatcgctgccaactaa

DBGET integrated database retrieval system