KEGG   Ursus maritimus (polar bear): 103669012Help
Entry
103669012         CDS       T03271                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00052  Galactose metabolism
umr00500  Starch and sucrose metabolism
umr01100  Metabolic pathways
umr04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103669012 (MGAM)
   00500 Starch and sucrose metabolism
    103669012 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103669012 (MGAM)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     103669012 (MGAM)
    3.2.1.20  alpha-glucosidase
     103669012 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trypsin Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103669012
NCBI-ProteinID: XP_008695547
UniProt: A0A384CL37
LinkDB All DBs
Position
Un
AA seq 2035 aa AA seqDB search
MEGLNHHLYLFYLDSSYQSCVGTLIAPQWVLTAAHCFLPDLQIIFYGSSINPGDFTGEIV
PYERVIIHPNFTVTSPKDDLMLIKLSLPFTFSTRSFRLSTLKNEVKDCLILTWLDNKDFI
GNSNYKLRRVGIRLRSNINCKKILGEKLLEDMFCIGPTLGSQEPCQAWFAIKFGWGRLSK
ILLTENSYEIASDVKSLYLEQKKENLSCNKKKKMARAKVKDFTTLEIMLSVLLLMVFIIT
IPLFVLSAKDSLESKDPGTSTTPDSSACPVVNEVERINCIPDQPPTKATCDQRGCCWRPQ
GTISVPWCYYSTSHGYQMEGDLVKTNAGFTAQLKRLPSPSLFGNDVNNVLLTAEYQTSNR
FHFKLTDQSKDRYEVPHEHVQPFGGDAASPLTYDVTVSKQPFSIRVIRRSNNRVLLDSGI
GPLLFADQFLQLSTRLPSANVYGLGEHVHQQYRHDMNWKTWSMFARDTTPNGDGTNLYGT
QTFFLCLEDASGLSFGVFLMNSNAMEVTLQPAPAITYRTIGGVLDFYVFLGNTPEQVVQE
YLELIGRPTLPSYWTLGFHLSRYDYGTLGSLKEVVDRNRAAGLPYDVQHADIDYMDERKD
FTYDPVNFKGFPEFVKELHSNSQKLVIIVDPAISNNSSPSNPYGPYDRGSSMKIWVNASD
GVTPLIGEVWPGNTVFPDFTNPSCAVWWANEFELFYNQVEFDGIWIDMNELSNFVDGSVS
GCSTSNLNYPPFTPRILDGYLFCKSLCMDAVQHWGKQYDVHNLYGYSMAIATAEAVKTVL
PNKRSFIITRSTFAGSGKFAAHWLGDNAATWDDLRWSIPGVLEFSLFGIPMVGADICGFA
LDTTEELCRRWMQLGAFYPFSRNHNGQGYKAQDPASFGADSLLLNSSRHYLTIRYTLLPY
LYTLFYRAHSRGDTVARPLLHEFYEDSNTWDVHQQFLWGPGLLITPVLDEGAEKVMAYMP
DAIWYDYETGARVRWRKQRVEMELPGDKIGLHLRGGHIFPTQQPATTTVASRQNPLGLII
ALDDNKEAKGELFWDDGETKDTVANQVYLFCEFSATQNSLDVKILQSTYKDPNNLVFKEI
KILGIQEPTNVTVKHNGVQSQVSPNVTYDSNLQVALIMGIDLILGEAYTVEWDLKIMDAE
KIDCFPDESGASAENCSARGCVWEVSTSPGVPFCYFVNDLYSVGDVQYDSRGATATISLK
SSVYASALPSVPVTSLSLRVTYHKNDMLQFKIYDPNNNRYEVPVPLNIPTVPSSTPESQL
YDVLIKKNPFGIEIRRKSTGTVIWDSQLLGFTFNDMFIRISTRLPSKYIYGFGETEHTAF
RRDLNWHTWGIFSRDEPPGYKKNSYGVHPYYMALEEDGSAHGVLLLNSNAMDVTFQPLPA
LTYRTIGGILDFYVFLGPTPELVTQQYTEMIGRPVMVPYWSLGFQLCRYGYENDAEIASL
YDEMVAAQIPYDVQYSDIDYMERQLDFTLSPNFMGFPALINRMKSDGMRVILILDPAISG
NETQPYPAFTRGVEDDVFIKAPNGGGIVWGKVWPDFPDIVINGSLDWDTQVELYRAYVAF
PDFFRNSTTTWWKRELQELYTNPQNPERSLKFDGMWIDMNEPSNFVNGAVPPGCKEAALN
YPPYMPYLESRDRGLGSKTLCMESEQILPDGSRVRHYDVHSLYGWSQTRPTYEAVQEVTG
QRGIVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQD
AEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDAAFVNMSRSVLQTRYTLLPYLYTL
MHMAHTEGSTVVRPLLHEFVSDQATWDIDSQFLLGPAFLVSAVLEPNARNVTAYFPRARW
YDYYTGVDIGARGEWKSLAAPLDHINLHVRGGYILPWQEPAQNTRLSRQKFIGFKVALDD
EGTAKGWLFWDDGESIDTYGEERYYLANFSASQNMMQSHIIFNKYITDSNPLKLGYIEIW
GVDSVSISSVSISVSGMVITPTFSYDPATQVLSIDVTNRDISLHNFISLTWGSTL
NT seq 6108 nt NT seq  +upstreamnt  +downstreamnt
atggaagggttaaatcatcatctttacttattttacctggattccagttatcagtcctgt
gtggggactttgatcgcgcctcagtgggtcttgacggcagcacactgcttcttacccgat
cttcagatcatcttctatggcagttccataaatcctggagactttactggggagattgta
ccttatgagagggtcatcattcacccaaacttcactgttacctctcctaaagatgacctc
atgctgataaagctgtctctaccttttaccttctccaccaggagttttcggttgtctact
ctcaagaatgaagtgaaagattgcttgattctcacttggttagacaacaaagactttatt
ggaaattcaaactataagctgcgaagagtcgggatccgattgaggtctaatataaactgc
aaaaaaatactgggtgaaaaactgcttgaagacatgttctgtataggacccacgctagga
agccaagagccctgccaggcttggtttgctatcaagtttggatggggcagactctccaaa
atccttctaacagagaactcatatgagatagcctctgatgtgaagagcttatacttggaa
caaaagaaggaaaacctcagctgcaataagaagaaaaagatggcaagagcgaaggtgaaa
gatttcacgactttggagattatgctcagtgttcttctgcttatggtgtttatcatcact
attcctctgtttgtgctttcagctaaagattctttggaatcaaaagatcctgggacaagt
accacccctgattcgtctgcgtgcccagtagtaaatgaagtggaacggataaactgcatc
cctgaccagccaccaacaaaggccacatgtgatcagcgtgggtgctgctggagacctcag
gggaccataagtgtgccctggtgctactattctacaagtcatggttaccagatggagggt
gaccttgtaaaaacaaatgcaggattcacagcccagttgaaaagattgccttctccatcc
ctatttggaaatgatgtcaacaatgtccttctcacagcagaataccagacgtccaatcgt
ttccattttaagctaactgaccagagcaaggacaggtacgaagtacctcatgagcacgtg
caacccttcggaggagatgctgcgtctcccttgacttacgacgttacggtctccaaacag
ccatttagcatcagagtgatcagaagaagcaataatcgtgttctgttggactcaggcatc
ggacccctcctgtttgctgatcagttcctgcagctctccacccgactgcccagcgctaac
gtgtatggtctgggagaacacgtgcaccaacagtaccggcatgatatgaattggaagacc
tggtccatgtttgccagggacacaacccccaatggggatggaactaacttgtatggaaca
cagacattcttcctgtgtcttgaagatgctagcggattgtcttttggagtgtttctgatg
aacagcaatgccatggaggttaccctccagcctgccccagccatcacttaccgcaccatc
gggggcgttcttgacttctatgtgtttttgggaaacactccagagcaagttgttcaagag
tatctagagctcattggaaggccaacccttccctcatactggacacttggatttcacctc
agtcgttatgattatggaacactagggagcttgaaggaagtcgtggacagaaaccgtgca
gcagggctcccttacgacgttcagcatgccgatattgattatatggatgagaggaaggac
ttcacttatgacccagtcaattttaaaggcttccctgagtttgttaaggagttacacagt
aacagtcagaaattggtcatcattgtggatccagccatctccaacaactcttcccccagc
aacccctacggcccgtacgacaggggttccagcatgaagatatgggtgaatgcttcagat
ggggtgactccactcattggggaggtctggcctggaaacactgtgtttcctgatttcacc
aaccccagttgtgctgtttggtgggcaaacgaattcgagctattctacaaccaagtagag
tttgatgggatctggattgatatgaatgaactctccaacttcgtcgatggttccgtttca
ggatgttccacgagcaatctaaattatcccccattcactcctagaatcctggatgggtac
ctgttctgcaagagtctctgcatggacgcagtgcagcactggggcaagcagtatgacgtc
cacaatctgtacggctactccatggcgatcgccacggcagaagctgtcaagactgtgctc
ccaaataagagaagtttcattataacccgttctacctttgcgggatctggcaagtttgct
gcccactggttaggagacaacgcagccacctgggatgatcttcggtggtctatccctggc
gtgctggaattcagcctttttggtatcccaatggtgggtgctgacatatgtggctttgcg
ctggacaccactgaggagctctgcaggcggtggatgcagctgggggcattttatccattt
tccaggaatcacaatggccaaggctacaaggcccaggatcctgcctcctttggagccgac
tctctgctgttgaactcctccaggcactaccttaccatccgctacactctattaccctac
ctctacaccctcttctaccgcgcccacagccggggggacacggtggccaggcctcttctg
catgagttctatgaggacagcaatacgtgggatgtgcaccaacagtttttatggggcccc
ggcctcctcatcactccggttctagatgagggtgcagagaaagtgatggcatatatgccc
gatgccatctggtacgattacgagactggggcccgagtgagatggaggaagcaaagagtg
gagatggaacttcctggagacaaaatcggacttcaccttcgcggaggccacatcttcccc
acgcaacagccagctaccaccacagtggccagtcgtcagaaccctcttggtcttatcatt
gccctagatgataacaaagaagcaaaaggcgagcttttctgggatgatggggaaaccaaa
gatactgtggccaatcaagtttatctcttttgtgagttttctgccacccaaaacagcttg
gatgtgaagattttgcagtcaacttacaaagaccccaataatttagtatttaaagagatt
aaaattcttgggatccaggaacctaccaatgttaccgtgaaacacaatggtgtccaaagt
caagtgtctcctaatgtcacttacgattctaacctacaggttgctcttatcatgggaatt
gatcttatcctgggagaagcatacacggtggagtgggacctgaagataatggatgcagaa
aaaatagactgtttccctgatgagagtggtgcttctgcagaaaactgtagtgcccgtggc
tgtgtctgggaggtatccacttctcctggagtcccgttttgttatttcgtcaatgatctg
tactctgttggagatgttcagtacgactcacgtggagccactgcgactatctccttaaag
tcttctgtctatgcctccgctctgccctcggtacccgtgacctccctcagtctgcgtgtg
acctaccataagaatgacatgctgcagtttaagatttatgatcccaacaataatcgatat
gaagtcccggtccctctcaacatacccacggttccatccagcacccctgagagtcaactc
tacgatgtcctcattaagaagaatccatttggaattgaaattcgccggaagagtacaggc
actgtgatttgggactctcagctccttggcttcaccttcaacgacatgttcatccgcatc
tccactcgccttccttccaagtacatctatggctttggggaaactgaacacacagccttt
cggagagacttgaactggcacacatgggggatattctccagagacgagcctccagggtac
aagaagaattcctatggcgtccacccctactacatggccctggaggaagatggcagtgcc
catggggtgcttctgctaaacagcaatgccatggatgtgacattccaacccctgcctgcc
ttgacgtaccgcaccattggaggaattctagacttttatgtgttcttggggccaactccg
gagcttgtcactcagcagtatactgagatgatcggtcgaccagtgatggttccttactgg
tctttggggtttcagctgtgtcgctatggatacgagaacgacgctgagattgccagcttg
tatgatgagatggtggctgcccagatcccttatgatgtgcagtactcggatatcgactac
atggagcggcagctggacttcaccctcagccccaacttcatgggattcccagctctgatt
aatcgcatgaagtcggatgggatgcgggtcatcctcattctggacccagccatttctggt
aacgagacacagccctatcccgcattcactcggggtgtggaagatgatgtcttcatcaaa
gctccaaatggtggaggcattgtctggggaaaggtgtggcctgatttccctgatatcgtt
ataaacgggtctctagactgggacactcaagtggagctataccgagcttatgtggccttt
cctgactttttccgtaactcaactaccacatggtggaagagggagttgcaagaactatac
accaatccacagaatccagagaggagcctgaagtttgatggcatgtggattgatatgaat
gagccatcgaattttgtgaatggagcagttcccccgggctgcaaggaggccgctctgaac
taccctccctatatgccatatttggagtccagggacaggggcctgggcagcaagaccctg
tgcatggagagtgagcagatccttccagatggctcgcgggtgcggcactatgacgttcac
agcctgtacggatggtcccagaccagacccacctacgaagccgtgcaggaggtgacggga
cagagaggaattgtcattacccgctccacgttcccctcttctggccgctgggcaggtcac
tggctgggtgataacacggccgcgtgggaccagctgaagaagtctatcattggcatgatg
gagttcagcctctttggcatatcttatacaggagcagatatttgtgggttctttcaagat
gctgaatatgagatgtgtgttcgctggatgcaactgggggccttttaccccttttcgagg
aaccacaacaccattgggaccaggaggcaagaccctgtgtcctgggatgctgccttcgtg
aatatgtccagaagtgtgctgcagaccagatacaccctgttgccttatctctacaccctg
atgcacatggcccacacggagggcagcacggtcgtgcggcctcttctccacgagtttgtg
tcagaccaggcgacatgggatatagacagtcagtttctgctgggcccagccttcctggtc
agcgccgtcctggagcctaatgccagaaatgtcactgcgtatttccctagagcccgctgg
tatgattactacacgggtgtggacattggagcaaggggagagtggaagtccttggcggcc
cctcttgaccacattaatcttcacgtccgtgggggttacatcctgccctggcaagagccc
gcacagaacactcgcttaagccgtcagaaattcataggcttcaaagttgccttggatgac
gaggggactgctaaaggctggctcttctgggatgatggggaaagcattgatacctatgga
gaagaacgctattacctggccaacttttctgccagccagaatatgatgcagagtcatata
attttcaacaaatacatcactgattcaaaccctttgaaactgggctacatcgagatctgg
ggagtggacagtgtttccatttccagtgtcagcatctctgtgagcggcatggtgataaca
cccaccttcagttatgaccctgcgacacaggtgttaagcattgatgtgaccaacagagac
atcagcctgcataatttcatttcactgacgtggggaagcactctgtga

DBGET integrated database retrieval system