KEGG   Ursus maritimus (polar bear): 103669102Help
Entry
103669102         CDS       T03271                                 

Gene name
MGAM2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00052  Galactose metabolism
umr00500  Starch and sucrose metabolism
umr01100  Metabolic pathways
umr04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103669102 (MGAM2)
   00500 Starch and sucrose metabolism
    103669102 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103669102 (MGAM2)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     103669102 (MGAM2)
    3.2.1.20  alpha-glucosidase
     103669102 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103669102
NCBI-ProteinID: XP_008695637
UniProt: A0A384CLC7
LinkDB All DBs
Position
Un
AA seq 2582 aa AA seqDB search
MAKKLSVLEVLLIIFFLTVLALDIFLMFFVFQKDEEAEFVPECPEIPESDRIDCAPGQVV
TEDVCRQQHKCCWKPVPDTNVPRCFFPRNWGYEANSIQNDTRTGFTAQLRKLPFPSLFGY
DVRDATFTAEYQTSNRFHFKISDTDNKRYEVPPEIINLSARTTNTSNLNYYIEVIDKPFS
IKIMRTSNRRVLLDTSIGPLQFAQQYLQLSFRLPSTTVYGLGEHVHQQYRHNMTWKTWPI
FTRDATPTEGMINLYGAHTFFLCLEDTSGSSFGVFLLNSNAMEVTLQPAPAITYRTIGGI
LDFYVFLGNTPEQVVQEYLELIGRPFLPPYWSLGFQLSRRNYSGINGLKKVVDRNRVAGI
PYDVQYSDIDYMDGNKDFTVDKQAFPNLSDFTSDLHKQGLKYVIVMNPGILNNSDYPPYM
SGRTKRVWVLGDNGFVVGQGYPGWTVFPDYSNPTCTQWWKEQLSEFHQTLEFDGVWIEMD
EVSSFLQGSDRGCEWNTFNFPPFTPRILDRLLFARTLCMDAEFQWGLHYDVHSLYGYSMA
KATHSAMENIFPNKSSFILSRSTFAGSGKYAAHWLGDNAATWDDLRWSIPSILEFNLFGI
PMVGANICGYTKNVTDELCTRWMQLGAFYPLSRNHNGPGFRDQDPAAFGEHSLLVNSSRY
YLNIRYTLLPYLYTLFYRAHARGDTVARPLVHEFYQDPATWDVREQFLWGPGLLITPVLY
EGVDRVKAYIPDAIWYDYETGVAIQWRKQWVEMLLPLDRIGLHLRGGFIFPTQQPNTTTE
ASRKNSLGLIVALDYKREAWGELYWDDGVSKDGEKQYILYDFSVSSNRLQANIINNSYTD
PNNLMFTDIIILGMDKQPTDFTVLLNNSATSISNVAYNVSSKVVEISDLRGLILGQGFSI
EWKLPVSDLEKFNCYPEDAAVSEESCKQRGCLWESTAVPDVPTCYYDTIPSYAASNIQYL
PTGITTDLAHLGAPASARAASRSLSTPVSLLRLSVVYHTENMLQFKIFDSMNKRYEVPVP
LNTPPSPVGSPEDRLYDVRIQNNPFGIQIRRKSSSTVIWDSQLPGFTFNDMFLSISTRLP
SQYIYGFGETEHTAFRRNMNWTTWGMFARDEPPAYKKNSYGVHPYYMALEEDGSAHGVLL
LNSNAMDVSFQPTPALTYRTTGGILDFYMVLGPTPELVTQQYTELIGRPAMTPYWALGFQ
LSRYGYQNDSEISHLYEAMMAAQIPYDVQHVDIDYMDRKLDFTLSPSFQNLSVLIEQMKN
NGMRFILILDPAISGNETQYRPFTRGQDSNVFIKWPDSNDIVWGKVWPELPNVNVNTSLD
HETQVKLYRANVAFPDFFRNSTAAWWKLEIKELYANSQESEKSLKFDGLWIDMNEPSNFV
DGSVRNCSDDILNNPPYVPYLESRDKGLSSKTLCMESEQVLPDGSRMRHYDVHSLYGWAQ
TRPTYEAVQEVTGQRGVVITRSTFPSSGRWGGHWLGDNTASWDQLRKSIIGMMEFSLFGI
SYTGADICGFFGNAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVAWNSTFEMFSRKVL
QTRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTNDNKTWDIDRQFMLGPALLISPVLESN
TSEISAYFPGARWYDYSMESGSVSTGEWKALSAPLDHINLHIRGGYILPWQEPAMNTHSS
RQKFMGLTVALDDNGKAEGQIFWDDGESIDTYANGNYFLAKFTAAQNLLQIQTIHNKYLS
DSNPLKVGYIKIWGTNSTSVTQVTFTYDNQQFTEMNFKSDPYNQTLTIQLTDKIISLEKL
TEVTWIYGGPIVSTTPMTSTFTTGSLYPSTVTTKATTFETILTSSATTSTTLISTTAFPT
SATEVTTSTTGPSTTTPFLTSTIEVITSSNVPNTTTPFPTGTTDFTANTPVPNTTTPSPP
NTTASSSTLPILGTPFLTGTTDFTANTPVPNTTTPSPSNTTASSSTLPITGTPFPTAATT
NFTAVPNTTTPSPPNTTTSTSALPITGTPFPTATTDFTASTPVPNTTTPSPPNTTTTSST
LPITGTPFPTGTTDFTASTPVPNTTTPSPPNTTTTSSTLPITGTPFPTGTTDFTASTPVP
NTTTPSPPNTTTTSSTLPITGTPFPTGTTDFTASTPVPNTTTPSRTPLPTATTAFTASTP
VPNTTTPSPPNTTTSSSALPITGTPFLTATTDFTANTPVPNTTTPSPPNTTTSTSALPIT
GTPFPTATTDFTASTPVPNTTTPSPPNPTTSSSALPITGTPFLTATTDFTANTPVPNTTT
PSLTSTTTASTSTTLPITSSPFPASTIDVTTSTAVTNTTLPSPISTTASISTTLPIITTA
FPTSNTDANTNTTVLITTTLSPISTDTSSTNNTVPITTTPSTNGSANSTINGFPIMTTFS
VTTHAMNTTVAMVTTSPISTDVASTGNHTPITSSPSPTISGGNSTSYTIPTMSTLSTDIY
TTSTNTIATPTTSTIHSTGHAVNITDADNSSSVPGNTTHVSIPNTTIALDTLMTALLDPA
THHQVTTNSTVSYLPIIVTNATTSIINTTAYALNTTIFDRPMNASATIPTYIANAINATL
VP
NT seq 7749 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaactcagtgtattggaagtccttctgatcatcttcttcctaactgtactg
gccttggatatcttcttgatgttttttgtgtttcagaaagatgaagaggctgaatttgtt
ccagagtgcccagagatccctgaatcagacaggatagactgtgctccaggccaggtggtg
acagaggatgtctgcaggcagcaacataagtgctgctggaaacctgtgccagacactaac
gtccctaggtgcttcttccccaggaactggggctacgaagccaacagtatccagaatgac
acaaggacagggtttacagcccagttgagaaagttgccattcccatctctgtttggatat
gatgtgagggatgccaccttcacagcggaatatcagacatccaatcgttttcattttaag
attagtgataccgacaacaaacgctatgaagtcccccctgaaattattaacctgtctgcg
aggactactaatacttccaatttgaactattacatagaggtcattgataagcccttcagc
atcaaaataatgaggacgagcaacagaagagtcctattggacacgagcatcgggcccctg
cagttcgcccagcagtacctgcagctgtccttccgtctgcccagcaccaccgtgtacggg
ctgggggagcacgtgcaccaacagtaccgccacaacatgacctggaagacctggcccatc
ttcacccgcgatgccacccccaccgagggcatgattaatctgtatggagctcatacattc
ttcctgtgccttgaagacaccagcggctcctcttttggggtttttctattgaacagtaat
gccatggaggtcaccctgcagcctgctcctgccatcacttaccgcacaattgggggcatc
cttgacttctatgtattcctgggaaatactccggaacaagtggttcaggaatacctggag
ctcattggacgaccattcctgcctccctactggagtcttgggttccagcttagtcgcagg
aactatagtggcatcaatggattgaagaaggttgtggatcgaaatcgtgtagctgggatc
ccttatgatgtccagtactctgacatagactacatggatggaaataaggatttcactgtc
gataaacaggctttccctaatctctcagattttaccagcgacttacataagcaaggactg
aaatatgtaatcgttatgaatcctggcatcttaaataactctgactaccccccgtatatg
agtggaaggacaaagagagtatgggtcttgggagacaatggctttgtcgttgggcaggga
taccccggatggaccgtctttccagactacagtaatccgacttgcactcagtggtggaag
gagcagctcagtgaatttcatcaaactcttgagtttgatggagtgtggattgaaatggat
gaagtatccagctttctgcaaggttccgatcgcgggtgtgaatggaacaccttcaacttt
cctcctttcactccccgaattctggaccgcttgctttttgcaagaaccctctgcatggat
gccgaatttcagtggggccttcactatgacgtccacagcttgtatggctactccatggca
aaagcaacacactcagccatggagaatatcttccccaacaaaagtagcttcatcttatcc
cgctctacttttgctggatctggcaaatatgctgcacactggttgggggacaatgcagcc
acatgggatgatctccgatggtccatccctagtatccttgagttcaacctatttggtatc
cccatggtaggtgccaacatctgtggttacacaaaaaatgtcacagatgagctctgcaca
agatggatgcagcttggagcattttatccactatcgaggaatcacaatgggcctgggttc
agggaccaggatccggctgcctttggcgagcactctctgctggtgaattcctccagatat
tatctgaacatccgctacaccctgctgccctacctctataccctcttctaccgagctcac
gcccggggggacaccgtagcaaggcccctggtccatgagttctaccaggacccagctact
tgggatgtgcgcgagcagttcttatgggggcctggactcctcatcacacctgttttatat
gagggtgtggaccgagtgaaagcttacataccagacgccatctggtacgactatgagaca
ggagtagccatccagtggaggaaacaatgggtggagatgctgctgccactcgacaggata
ggacttcatctccgagggggcttcatatttcccacccagcagcccaacacaaccacagag
gccagtcggaagaattccctgggactcattgttgccttggactacaagagagaggcatgg
ggcgagctgtactgggatgatggtgtgtctaaagatggtgaaaagcagtatattctgtat
gatttttctgtcagctctaaccgtcttcaggcaaatattataaataatagctatacggac
cctaacaacctcatgtttacagatatcataatcttgggaatggacaagcaacctactgat
tttaccgtcttacttaataattctgccacctccatttcaaatgttgcctacaatgtttca
tcaaaggtggtggagatcagtgatctcaggggactgatactcggtcaaggattctccatt
gaatggaaacttccagtcagtgacctggagaaattcaactgctaccctgaggatgctgcc
gtctctgaggagagttgcaagcagcgggggtgcctttgggagtccacagctgttcctgat
gtgcccacctgttactacgacaccatccctagttatgccgccagtaacattcagtacctg
cctacgggcatcaccacagacctcgcccacctcggggcccctgcatcagcccgggctgcc
tctcgctcgctctccacgccagtcagcctcctccggctgagcgtggtctaccacacagaa
aacatgctgcagttcaagatctttgattccatgaacaaaaggtatgaggtcccagtgcct
ctaaacacccctccctctccagttggctcccctgaagaccgtctgtatgacgtcaggatt
cagaacaatccttttgggatccagattcgacgaaaaagctccagcactgtgatttgggat
tctcagctgcctggcttcacgttcaacgacatgttcctctccatttctactcgcctcccc
tctcagtacatctatggctttggggagacagagcacacagctttcagaagaaatatgaac
tggaccacgtggggaatgtttgctcgtgatgaacccccagcgtacaagaagaattcctat
ggcgtccacccctactacatggccctggaggaagatggcagtgcccatggggtgcttctg
ctaaacagcaatgccatggatgtgtcattccagcccactcctgccctgacataccgcacc
acaggagggattttggacttttatatggttttggggccaacccctgagcttgtaactcaa
caatacactgagttgattggtcggccggcaatgactccatactgggccttgggattccag
ctaagtcgctatggataccagaatgattctgagatctcccacttgtatgaggcaatgatg
gcggcccagattccctatgatgtccagcatgtagacatcgattacatggacaggaagctg
gacttcactctcagccccagcttccaaaacctcagcgtcctgattgagcaaatgaagaat
aatggcatgagattcattctcattctggacccagccatttctggcaacgagacccagtat
cgcccattcaccagagggcaggatagcaatgtattcatcaaatggcccgacagcaatgac
attgtctggggaaaggtttggccagaactgcccaacgtgaatgtgaatacctcccttgac
catgaaactcaggttaagctgtacagagccaacgttgcttttcccgacttctttcgtaat
agcacagctgcatggtggaagctggaaataaaagagctctatgcaaattctcaagagtca
gagaagagcttgaagtttgacggattgtggattgatatgaatgagccatcaaactttgtg
gatggatctgtcaggaactgcagtgatgacattcttaataacccaccctacgtgccatat
ttggagtccagggacaagggcctgagcagcaagaccctgtgcatggagagtgagcaggtc
ctgccagacggctcccggatgcggcactatgacgttcacagcctgtacggatgggcccag
accagacccacctacgaagctgtgcaggaggtgacgggacagcgaggggtcgtcatcacc
cgctccacattcccctcttctggccgctggggaggccactggctgggtgacaacacagcc
tcgtgggaccagctgaggaaatcgatcattggcatgatggagttcagtctcttcggaata
tcgtatacaggagcagatatttgtggcttctttggaaatgctgagtatgagatgtgtgtt
cgctggatgcaactgggggccttttatcccttttccagaaaccacaacaccatcgggaca
aggagacaagatcctgtggcctggaattcaacctttgagatgttctccagaaaagtcctt
cagaccagatacaccctgttgccctacctctacactttgatgcataaagctcacgttgag
ggcagcactgtcgtccgaccccttctccatgagtttacgaatgacaacaaaacgtgggat
atagaccgtcagttcatgttgggtcctgctctcttaatcagccccgtgctggaaagtaac
acttctgagatctctgcttattttcctggagcccgttggtatgactacagcatggaatct
ggcagtgtgtcgacaggtgagtggaaagccctgagtgctccccttgaccacatcaacctt
catatcagagggggctacatcctgccttggcaagagcctgcgatgaacactcactccagt
cgacaaaaatttatgggattgactgttgcattggacgacaatgggaaagctgaaggccag
atattctgggatgatggagaaagcattgatacctatgcaaatgggaactatttcttggca
aaatttacagcagctcagaatctattgcaaatccagaccatacacaataagtatttgagt
gactcgaatccactgaaagttggatatattaaaatctgggggacaaactctacttctgtg
acacaagtcactttcacctacgacaaccagcaattcacagagatgaatttcaagagtgac
ccttacaatcagactctgactattcaactgactgacaagattatcagcctagaaaagcta
actgaggttacttggatatacggtggccctatagtttctactacacctatgacaagtacc
ttcacaacaggttctctatatccttctacagttactactaaggctaccacttttgagact
attctcactagttctgccactactagtactactcttatctcaaccactgctttcccaaca
agtgctactgaagttacaactagtactactggccctagtaccactacacctttcctaaca
agtactattgaagttataactagttctaatgttcctaataccactactcctttcccgaca
ggtactactgactttacagctaatactcctgttcctaataccactacaccttccccccca
aatactaccgctagcagtagtacccttccaatcctaggcactcctttcctgacaggtact
actgactttacagctaatactcctgttcctaataccactacaccttccccctcaaatact
accgctagcagtagtacccttccaatcacaggcactccctttccgacagctgctactact
aactttacagctgttcctaataccactacgccttcccccccaaatactaccactagcact
agtgctcttcctatcacaggcactcctttcccgacagctactactgactttacagctagt
actcctgttcctaataccactacgccttctcccccaaatactaccactaccagtagtacc
cttcctatcacaggcactcctttcccgacaggtactactgactttacagctagtactcct
gttcctaataccactacgccttctcccccaaatactaccactaccagtagtacccttcct
atcacaggcactcctttcccgacaggtactactgactttacagctagtactcctgttcct
aataccactacgccttctcccccaaatactaccactaccagtagtacccttcctatcaca
ggcactcctttcccgacaggtactactgactttacagctagtactcctgttcctaatacc
actacgccttctcgcactcctctcccgacagctactactgcctttacagctagcactcct
gttcctaataccactacgccttcccccccaaatactaccactagcagtagtgctcttcca
atcacaggcactcctttcctgacagctactactgactttacagctaatactcctgttcct
aataccactacgccttcccccccaaatactaccactagcactagtgctcttcctatcaca
ggcactcctttcccgacagctactactgactttacagctagtactcctgttcctaatacc
actacgccttcccccccaaatcctaccactagcagtagtgctcttccaatcacaggcact
cctttcctgacagctactactgactttacagctaatactcctgttcctaataccactacg
ccttccctgacaagtaccactactgctagcactagtactacccttcctatcacaagctct
cccttcccagcaagcactattgatgttacaactagtactgctgttactaataccactctg
ccttcccctataagtaccactgctagcattagtactactcttcctatcataaccactgct
ttcccaacaagtaatactgatgctaacaccaatactactgttctaattaccactactctt
tctccaataagtactgatactagtagcaccaataatactgttccaattacaactactcct
tctacgaatggtagtgctaatagtactatcaatggttttcctattatgactactttttct
gtaactactcatgctatgaacactactgttgctatggtaaccacttctcctataagtact
gatgttgctagcactggcaaccatactcccattaccagttctccttcccctacaatatct
ggtggtaatagtactagttatactattcctacaatgtctactctttctacagatatttac
actactagcactaataccatagctacccctaccaccagtactatacatagtacagggcat
gcagtaaatattactgatgcagataactctagcagtgttccaggtaacactacacatgtt
tctattccaaataccacaatagccttagacacattaatgactgctcttctagacccagca
acacaccatcaggtaacaacaaactctacagtcagttatttacctattattgtaactaat
gctaccaccagtattataaatactactgcatatgctctaaatactaccatttttgataga
ccaatgaatgcttctgctaccataccaacttatattgcaaatgccataaatgctactcta
gttccatga

DBGET integrated database retrieval system