KEGG   Ursus maritimus (polar bear): 103669314Help
Entry
103669314         CDS       T03271                                 

Definition
(RefSeq) pancreatic alpha-amylase-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00500  Starch and sucrose metabolism
umr01100  Metabolic pathways
umr04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103669314
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103669314
Enzymes [BR:umr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     103669314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 103669314
NCBI-ProteinID: XP_008695860
LinkDB All DBs
Position
Un
AA seq 543 aa AA seqDB search
MEVEKQWKNGLAGTSSTISNEWRINSGWKECWQLQSKMKFFLLLSVIGFCWAQYDPNTKP
GRTSIVHLFEWRCDVSNMLLIFSFVAKDISPPNENLVVNNPFRPWWERYQPISYKLCTRS
GNEDEFRDMVTRCNNVGVRIYVDAVINHMCGNAASAGTSSTCGSYFNPGSRDFPAVPYSG
WDFNDGKCKTGSGDIESYNDPYQVRDCRLVGLLDLALEKDYVRSTIAEYMNRLIDIGVAG
FRIDASKHMWPGDIKAVLDKLHNLNTQWFSEGSKPFIFQEVIDLGGEPIKSEEYFGNGRV
TEFKYGAKLGTVLRRWNGEKMAYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASIL
TFWDARLYKMGVGFMLAHPYGFTRVMSSFRWSRYFQNGVDVNDWIGPPNNNGVIKEVTIN
PDTTCGNDWVCEHRWRQIRNMVMFRNVVDGQPFTNWWDNGSNQVAFGRGNRGFIVFNNDD
WALSSTLQTGLPAGTYCDVISGDKIDSNCTGIKIYVSGDGNAHFSISNSAEDPFIAIHAE
SKL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggaagttgagaaacaatggaaaaatggactagccgggacttctagtactatatcgaat
gagtggaggataaatagtggctggaaagaatgctggcaacttcaaagcaaaatgaagttc
ttcctattgctttccgtcattgggttctgctgggctcagtatgacccaaataccaaacct
ggacggacatctatcgtccatctgttcgagtggcgctgtgatgtttccaatatgctgtta
atattttcatttgttgctaaagatatctctccacccaatgaaaatcttgtggttaataac
ccttttagaccttggtgggaaaggtaccaaccaattagctacaagttatgcacaagatcc
ggaaatgaagatgaattcagagacatggtgactcgatgtaacaacgttggtgtccgtatt
tatgtggatgctgtcattaatcatatgtgtgggaatgctgcgagtgcaggaacgagcagt
acttgtggaagctacttcaaccctggaagtagagattttccagcagtcccatactctggt
tgggattttaatgatggtaaatgtaaaactggaagtggagacattgagagctataatgat
ccttatcaggtccgagattgtcgtctggttggtcttcttgatcttgcgctggagaaagac
tatgtgcgttccacgattgctgaatatatgaaccgcctcatcgacattggtgtagcgggg
ttcagaattgatgcttctaagcacatgtggcctggagacatcaaggccgttttggataaa
ctgcataatctaaatacacagtggttctctgaaggaagtaaacctttcattttccaggag
gtaattgatctgggtggtgagccaattaaaagcgaggagtactttggaaatggccgtgtg
acagaattcaagtatggtgcaaaactaggcacagtcctgcgcagatggaatggagagaag
atggcttacttaaagaactggggagaaggatggggtttcatgccttctgatcgagcactt
gtgtttgtggataaccatgacaatcagcgaggacacggagctgggggagcatctattctt
acattctgggacgccagactgtacaaaatgggagttggatttatgctcgctcatccatat
ggatttacacgagtaatgtcaagcttccgatggtcaagatattttcaaaatggagtagat
gttaatgattggattgggccaccaaataataatggggtaattaaagaagttactattaat
cccgacactacttgtggtaacgattgggtctgtgaacatcgatggcgtcaaataaggaac
atggttatgttccgtaatgtagttgatggccaaccttttacaaactggtgggataacggt
agcaaccaagtagcttttggaagaggaaacagaggattcattgtctttaacaatgatgac
tgggcgttatcttcaactttgcaaactggtcttcctgccggcacatattgtgatgtcatt
tctggagacaaaattgacagcaattgtacgggaatcaaaatctatgtttctggggatgga
aatgctcatttttccattagtaactctgctgaagatccgttcattgcaattcatgctgaa
tctaagttgtaa

DBGET integrated database retrieval system