KEGG T03271: 103669422

KEGG Orthology (KO) [BR:umr00001]
09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103669422 (NRAS)
   04012 ErbB signaling pathway
    103669422 (NRAS)
   04014 Ras signaling pathway
    103669422 (NRAS)
   04015 Rap1 signaling pathway
    103669422 (NRAS)
   04370 VEGF signaling pathway
    103669422 (NRAS)
   04371 Apelin signaling pathway
    103669422 (NRAS)
   04068 FoxO signaling pathway
    103669422 (NRAS)
   04072 Phospholipase D signaling pathway
    103669422 (NRAS)
   04071 Sphingolipid signaling pathway
    103669422 (NRAS)
   04151 PI3K-Akt signaling pathway
    103669422 (NRAS)
   04150 mTOR signaling pathway
    103669422 (NRAS)
09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103669422 (NRAS)
   04137 Mitophagy - animal
    103669422 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    103669422 (NRAS)
   04218 Cellular senescence
    103669422 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103669422 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    103669422 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103669422 (NRAS)
09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103669422 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    103669422 (NRAS)
   04660 T cell receptor signaling pathway
    103669422 (NRAS)
   04662 B cell receptor signaling pathway
    103669422 (NRAS)
   04664 Fc epsilon RI signaling pathway
    103669422 (NRAS)
   04062 Chemokine signaling pathway
    103669422 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103669422 (NRAS)
   04929 GnRH secretion
    103669422 (NRAS)
   04912 GnRH signaling pathway
    103669422 (NRAS)
   04915 Estrogen signaling pathway
    103669422 (NRAS)
   04917 Prolactin signaling pathway
    103669422 (NRAS)
   04921 Oxytocin signaling pathway
    103669422 (NRAS)
   04926 Relaxin signaling pathway
    103669422 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    103669422 (NRAS)
   04919 Thyroid hormone signaling pathway
    103669422 (NRAS)
   04916 Melanogenesis
    103669422 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    103669422 (NRAS)
   04726 Serotonergic synapse
    103669422 (NRAS)
   04720 Long-term potentiation
    103669422 (NRAS)
   04730 Long-term depression
    103669422 (NRAS)
   04722 Neurotrophin signaling pathway
    103669422 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    103669422 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    103669422 (NRAS)
   04213 Longevity regulating pathway - multiple species
    103669422 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    103669422 (NRAS)
09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103669422 (NRAS)
   05206 MicroRNAs in cancer
    103669422 (NRAS)
   05205 Proteoglycans in cancer
    103669422 (NRAS)
   05203 Viral carcinogenesis
    103669422 (NRAS)
   05230 Central carbon metabolism in cancer
    103669422 (NRAS)
   05231 Choline metabolism in cancer
    103669422 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103669422 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103669422 (NRAS)
   05225 Hepatocellular carcinoma
    103669422 (NRAS)
   05226 Gastric cancer
    103669422 (NRAS)
   05214 Glioma
    103669422 (NRAS)
   05216 Thyroid cancer
    103669422 (NRAS)
   05221 Acute myeloid leukemia
    103669422 (NRAS)
   05220 Chronic myeloid leukemia
    103669422 (NRAS)
   05218 Melanoma
    103669422 (NRAS)
   05211 Renal cell carcinoma
    103669422 (NRAS)
   05219 Bladder cancer
    103669422 (NRAS)
   05215 Prostate cancer
    103669422 (NRAS)
   05213 Endometrial cancer
    103669422 (NRAS)
   05224 Breast cancer
    103669422 (NRAS)
   05223 Non-small cell lung cancer
    103669422 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103669422 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    103669422 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    103669422 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103669422 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103669422 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    103669422 (NRAS)
   05161 Hepatitis B
    103669422 (NRAS)
   05160 Hepatitis C
    103669422 (NRAS)
   05163 Human cytomegalovirus infection
    103669422 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103669422 (NRAS)
   05165 Human papillomavirus infection
    103669422 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103669422 (NRAS)
   01522 Endocrine resistance
    103669422 (NRAS)
09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103669422 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103669422 (NRAS)
   04031 GTP-binding proteins [BR:umr04031]
    103669422 (NRAS)
Membrane trafficking [BR:umr04131]
Endocytosis
  Macropinocytosis
   Ras GTPases
    103669422 (NRAS)
Exosome [BR:umr04147]
Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103669422 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   103669422 (NRAS)
  Exosomal proteins of breast cancer cells
   103669422 (NRAS)
  Exosomal proteins of colorectal cancer cells
   103669422 (NRAS)
GTP-binding proteins [BR:umr04031]
Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    103669422 (NRAS)

SSDB

Motif

Pfam:

Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA Ldh_1_N

Other DBs

NCBI-GeneID:

103669422

NCBI-ProteinID:

XP_008695968

UniProt:

A0A384CMD2

LinkDB

Position

AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM

NT seq 570 nt +upstreamnt +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgtcgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagacggtgaaacctgtctgttggacatactggatacagctggt
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggtttcctctgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aagcgagtcaaagattcagatgacgtacctatggtgctagtaggaaataagtgtgatttg
ccaacaaggacagtggacacaaaacaagcccacgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgatgggactcaaggt
tgtatggggttaccatgtgtggtgatgtaa

DBGET integrated database retrieval system