KEGG   Ursus maritimus (polar bear): 103669705
Entry
103669705         CDS       T03271                                 

Gene name
MMP9
Definition
(RefSeq) matrix metallopeptidase 9
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04657  IL-17 signaling pathway
umr04668  TNF signaling pathway
umr04670  Leukocyte transendothelial migration
umr04915  Estrogen signaling pathway
umr04926  Relaxin signaling pathway
umr05161  Hepatitis B
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05215  Prostate cancer
umr05219  Bladder cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103669705 (MMP9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    103669705 (MMP9)
   04670 Leukocyte transendothelial migration
    103669705 (MMP9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103669705 (MMP9)
   04926 Relaxin signaling pathway
    103669705 (MMP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103669705 (MMP9)
   05202 Transcriptional misregulation in cancer
    103669705 (MMP9)
   05206 MicroRNAs in cancer
    103669705 (MMP9)
   05205 Proteoglycans in cancer
    103669705 (MMP9)
  09162 Cancer: specific types
   05219 Bladder cancer
    103669705 (MMP9)
   05215 Prostate cancer
    103669705 (MMP9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103669705 (MMP9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103669705 (MMP9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103669705 (MMP9)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     103669705 (MMP9)
Peptidases and inhibitors [BR:umr01002]
 Metallo peptidases
  Family M10
   103669705 (MMP9)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 PT Reprolysin_4 DUF4953 Reprolysin_3 Peptidase_M66 Reprolysin_5
Other DBs
NCBI-GeneID: 103669705
NCBI-ProteinID: XP_008696269
UniProt: A0A384CP67
LinkDB
Position
Un
AA seq 706 aa
MNPRQPLVLVLLVLGCCSAAPRPHKPTLVVFPGDLRANLTDKQLAEEYLFRYGYTKVAEM
NEDKQSLSRTLRLLQRRLALPETGELDKTTLDAMRAPRCGVPDLGRFQTFEGDLKWHHRD
ITYWIQNYSDDLPRNVIDDAFARAFALWSAVTPLTFTRVYGPEADIVIQFGVREHGDGYP
FDGKNGLLAHAFPPGQGIQGDAHFDDEELWSLGKGVVVPTYFGNSDGAPCHFPFTFEGRS
YSACTTDGRSDDMGWYTDGVWVNKLMRLPVIVWASPGLYTQDGNGDGKPCVFPFTFEGKS
YSSCTTEGRSDGYRWCATTANYDQDRLYGFCPTRVDSTVTGGNSAGEPCVFPFIFLGKEY
STCTTEGRGDGYLWCATTSNFDRDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEAL
MYPMYSFTEGPPLHEDDVKGIQSLYGPRPDPEPQPPTVQPTAPPTGCPTGPPTTRPSERP
TTGPTGPPAAGPTGPPTAGPSEPPTVTFNPAEDICKVNFFDAIAEIGNCLHFFKDGKYWR
FSDGKARRVQGPFLITDSWPALPHKLDSAFEDPLTRKIFFFSGRQVWVYAGASVLGPRRL
DKLGLGPEVAQVTGALPQGGAKVLLFSWQRFWRFDVKTQTVDPNSLGSVGRVFPGVPLNS
HNIFQYQGKAHFCQDRFYWRVNSRNEVNQVDEVGYVTYDFLRCPED
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgaaccccaggcagcccctggtcctggtgctcctggtgctgggctgctgctctgcggct
cccagaccacacaagcccacccttgtggtcttcccaggagacctgagagctaatctcact
gacaagcagctggcagaggaatatctgtttcgctatggctacacgaaagtggccgagatg
aacgaggacaagcagtccctgagtcggacgctgcggcttctccagaggcgcctggctctg
cctgagactggagagctggacaaaaccaccctggacgccatgcgggccccgcgctgcggc
gtcccggacctgggcagattccagacctttgagggcgacctcaagtggcaccaccgggac
atcacttactggatccaaaactactcggacgacttgccgcgcaacgtgatcgacgacgcc
tttgcccgcgccttcgcgctctggagcgcggtgacgccgctcaccttcactcgcgtgtac
ggccccgaagccgacatcgtcattcagtttggtgttagggagcacggagatggatatccc
ttcgatgggaagaacgggctcctggcacacgcctttcctccgggccagggcattcaggga
gacgcccacttcgacgatgaagagttgtggtctctgggcaagggcgtcgtggttccgacc
tacttcggaaactcagatggcgccccctgccacttccccttcaccttcgagggccgctcc
tactccgcttgcaccacggacggccgctccgacgacatggggtggtacacagatggtgtg
tgggtcaataaactcatgcgccttccggtcatcgtgtgggcctccccaggactctacacc
caggacggcaatggggacggcaagccctgcgtgtttccgttcaccttcgagggcaaatct
tactccagctgcaccaccgaaggtcgctcggacggctaccgctggtgcgccaccacagcc
aactacgaccaggacagactctatggcttctgccccacccgagtcgactccacggtgacc
gggggcaactctgcgggggagccgtgtgtcttccccttcatcttcctgggcaaggagtac
tcgacctgcactacggagggccgcggagatggatacctctggtgtgccaccacctcgaac
tttgacagagacaagaagtggggcttctgcccggaccaaggatacagcctgttccttgtg
gccgcccatgagtttggccacgcgctgggtttagatcactcatcggtgccggaagcactc
atgtaccccatgtacagcttcaccgaggggccccccctgcatgaggatgatgtgaagggc
atccagtctctgtatggtcctcgccctgaccctgaaccacagcctccaaccgttcagccc
accgctccaccaaccggctgccctaccgggcctcccactacccgcccctcagagcgcccc
actactggccccacaggcccccctgcagctggccccacaggtccccccactgctggccct
tctgagccccctacagtgactttcaacccagcagaggatatatgcaaagtgaacttcttc
gatgccatcgcggagatcgggaactgtctgcatttcttcaaggatgggaagtactggcga
ttctctgacggcaaggcgcgccgggtgcagggccccttccttataactgactcgtggcct
gcgctgccccacaagctggactccgcctttgaggacccgctcaccaggaagattttcttc
ttctctgggcgccaggtgtgggtgtacgcaggcgcgtcggtgctgggcccgaggcgtctg
gacaagcttggcctgggcccggaggtggcccaagtcacaggggccctcccgcaaggcggg
gctaaggtgctactgtttagctggcaacgcttctggaggttcgacgtgaagacgcagacc
gtcgatccgaacagcctcggctcggtggggcgggtgttccccggggtgcccctgaactcg
cacaacatcttccagtaccaagggaaagcccacttctgccaggaccgtttctactggcgt
gtgaattctcggaatgaggtgaaccaggtggacgaagtgggctacgtgacctatgacttc
ctacggtgcccggaggattag

DBGET integrated database retrieval system