KEGG   Ursus maritimus (polar bear): 103669776
Entry
103669776         CDS       T03271                                 

Gene name
SRC
Definition
(RefSeq) SRC proto-oncogene, non-receptor tyrosine kinase
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr04012  ErbB signaling pathway
umr04015  Rap1 signaling pathway
umr04062  Chemokine signaling pathway
umr04137  Mitophagy - animal
umr04144  Endocytosis
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04510  Focal adhesion
umr04520  Adherens junction
umr04530  Tight junction
umr04540  Gap junction
umr04611  Platelet activation
umr04625  C-type lectin receptor signaling pathway
umr04727  GABAergic synapse
umr04750  Inflammatory mediator regulation of TRP channels
umr04810  Regulation of actin cytoskeleton
umr04912  GnRH signaling pathway
umr04915  Estrogen signaling pathway
umr04917  Prolactin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr04921  Oxytocin signaling pathway
umr04926  Relaxin signaling pathway
umr05100  Bacterial invasion of epithelial cells
umr05135  Yersinia infection
umr05152  Tuberculosis
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05203  Viral carcinogenesis
umr05205  Proteoglycans in cancer
umr05219  Bladder cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103669776 (SRC)
   04015 Rap1 signaling pathway
    103669776 (SRC)
   04370 VEGF signaling pathway
    103669776 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103669776 (SRC)
   04137 Mitophagy - animal
    103669776 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103669776 (SRC)
   04520 Adherens junction
    103669776 (SRC)
   04530 Tight junction
    103669776 (SRC)
   04540 Gap junction
    103669776 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103669776 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103669776 (SRC)
   04625 C-type lectin receptor signaling pathway
    103669776 (SRC)
   04062 Chemokine signaling pathway
    103669776 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103669776 (SRC)
   04915 Estrogen signaling pathway
    103669776 (SRC)
   04917 Prolactin signaling pathway
    103669776 (SRC)
   04921 Oxytocin signaling pathway
    103669776 (SRC)
   04926 Relaxin signaling pathway
    103669776 (SRC)
   04919 Thyroid hormone signaling pathway
    103669776 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    103669776 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103669776 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    103669776 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103669776 (SRC)
   05203 Viral carcinogenesis
    103669776 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    103669776 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103669776 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103669776 (SRC)
   05152 Tuberculosis
    103669776 (SRC)
   05100 Bacterial invasion of epithelial cells
    103669776 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103669776 (SRC)
   05168 Herpes simplex virus 1 infection
    103669776 (SRC)
   05163 Human cytomegalovirus infection
    103669776 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103669776 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103669776 (SRC)
   01522 Endocrine resistance
    103669776 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103669776 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103669776 (SRC)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     103669776 (SRC)
Protein kinases [BR:umr01001]
 Non-receptor tyrosine kinases
  SRC family
   103669776 (SRC)
Membrane trafficking [BR:umr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    103669776 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    103669776 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    103669776 (SRC)
  Macropinocytosis
   Kinases
    103669776 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3
Other DBs
NCBI-GeneID: 103669776
NCBI-ProteinID: XP_008696339
UniProt: A0A384CND9
LinkDB
Position
Un
AA seq 536 aa
MGSNKSKPKDASQRRRSLEPAENTHGGGGGAFPTSQTPSKPASADGHRGPSTAFPSAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgccagccaacggcgccgcagcctggagccc
gctgagaacacccacggtggcggcgggggtgccttccccacctcacagacacccagcaag
ccagcctctgctgatggccaccgaggccctagtacggccttcccctccgcagctgccgag
cccaagctgttcgggggcttcaactcgtcagacacagtcacctccccacagagggcgggg
ccgctggctggtggagtgaccacctttgtggccctctatgactatgagtctcggacagag
accgacctgtccttcaagaaaggggagcggctccagattgtcaacaacacagagggtgac
tggtggctggcccactcgctcagcacgggacagacgggttacatccctagcaactatgtg
gcaccctccgactctatccaggccgaggagtggtactttggcaagatcaccagacgggag
tcggaacggttactgctcaatgcggagaacccgagagggaccttcctagtgcgagaaagt
gagaccacgaaaggtgcctactgcctctccgtgtctgatttcgacaacgccaagggcctc
aacgtgaagcactacaagatccgcaagctggacagcggcggcttctacatcacgtcccgc
acccagttcaacagtctgcagcagctggtggcctactactccaaacatgctgacggtctg
tgccaccgcctcaccactgtgtgccctacgtccaagccccagactcagggcctggccaag
gatgcctgggagatccctcgggagtccctgcggctggaggtcaagctgggccaaggctgt
ttcggagaggtgtggatggggacctggaatggaaccaccagggtggccatcaaaaccctg
aagccaggcacgatgtctccggaggccttcctgcaggaggcccaggtcatgaagaaactg
aggcacgagaagctggtgcagctgtatgcggtggtgtctgaggaacctatctacatcgtc
acggagtacatgagcaaggggagtctgctggactttctcaagggggagacgggcaagtac
ctgcggctgcctcagctggtggacatggctgctcagatcgcctcaggcatggcctacgtg
gaacggatgaactatgtccaccgggacctccgtgctgccaacatcctggttggagagaac
ctcgtgtgcaaagtggctgactttgggctggctcggctcatcgaagacaatgagtacacg
gcccggcaaggtgccaaattccccatcaagtggacagctcccgaagcggccctctacggc
cggttcaccatcaagtcagatgtatggtcctttgggatcctgctgacggagctcacaaca
aagggacgggtgccctaccctgggatggtcaaccgtgaggtgctggaccaggtggagcgg
ggctaccgaatgccctgcccgcccgagtgtcccgagtccctgcacgacctcatgtgccag
tgctggcggaaggagccggaggagcggcccaccttcgagtacctgcaggccttcctggaa
gactacttcacgtccaccgagccccagtaccagcctggagagaacctatag

DBGET integrated database retrieval system