KEGG   Ursus maritimus (polar bear): 103669878
Entry
103669878         CDS       T03271                                 

Gene name
STK4
Definition
(RefSeq) serine/threonine kinase 4
  KO
K04411  serine/threonine kinase 4
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04068  FoxO signaling pathway
umr05200  Pathways in cancer
umr05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103669878 (STK4)
   04014 Ras signaling pathway
    103669878 (STK4)
   04068 FoxO signaling pathway
    103669878 (STK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103669878 (STK4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    103669878 (STK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103669878 (STK4)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: STE group
  STE20 family
   103669878 (STK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Mst1_SARAH Pkinase_fungal Abi_2 Haspin_kinase DUF4611
Other DBs
NCBI-GeneID: 103669878
NCBI-ProteinID: XP_008696461
UniProt: A0A384CNR0
LinkDB
Position
Un
AA seq 541 aa
MASWPESQCPGRTARHRDGTANGLEPDGQSGFRGAPGAPRDSGTVPRGPGWVFAAPPHLR
AARRFRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESD
LQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEI
ATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIG
TPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRK
PELWSDNFMDFVKQCLVKSPEQRATATQLLQHPFVKSAKGVSILRDLINEAMDVKLKRQE
AQQREVDQDDEENSEEDEMDSGTMVRAAGDEMGTVRVASTVSDGASTMIEHGDTLPSQLG
TMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGQSVPGPLRNSSDWK
VPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQN
F
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggcttcgtggcctgagtcccagtgtcccgggcgaaccgcgcggcaccgagacggcacc
gccaacggactcgagccggacggacagtcggggttccggggcgcgcccggcgcgccacgt
gactcaggcaccgtaccacgtggtcccggctgggtcttcgccgccccgccccacttgcgc
gcggcgcgccgcttccggcagctgaaaaagttggatgaggatagtttaactaaacaacca
gaagaagtgtttgatgtcttagagaaacttggagaagggtcctatggcagtgtatacaaa
gcaattcacaaagagactggtcagattgtcgctattaagcaagttcctgtggaatcagac
ctgcaggagataatcaaagaaatctctataatgcaacaatgtgacagccctcacgtagtc
aaatattatggcagttattttaagaacacagacttgtggatcgttatggagtactgtggg
gctggttctgtgtctgatatcattcgattacgaaataaaacgttaacagaagatgagata
gctacaatattacaatcaacacttaagggactggaataccttcattttatgagaaaaata
caccgagatatcaaggcaggaaatattttgctaaatacagaaggacatgcaaaacttgca
gattttggggtagcaggtcaacttacagataccatggccaaaaggaacacagtgatagga
acaccattttggatggctccagaagtgattcaggaaattggatacaactgtgtggcagac
atctggtcgttgggaataactgccatagaaatggctgagggaaagccgccatatgccgat
atccatccaatgagggcgatcttcatgattcccaccaaccctccccccacatttcgaaag
ccagaactgtggtccgataacttcatggattttgtgaagcagtgtcttgtaaaaagccct
gagcagagagccacagccactcaactcctacagcacccatttgtcaagagtgccaaggga
gtgtcgatactgcgggacttaattaacgaggccatggatgtgaagctgaaacgccaggaa
gcccagcagcgggaggtggaccaggacgacgaggagaactccgaggaggatgagatggac
tccggcacgatggttcgagcagcgggtgatgagatgggcactgtccgggtagccagcacc
gtgagtgatggagccagcactatgatcgagcacggggacacattgccgtcacagctgggc
accatggtgatcaacgcggaggatgaggaagaggaagggaccatgaaaagaagggatgag
accatgcagcctgccaaaccatctttccttgaatactttgaacaaaaagaaaaggaaaat
cagatcaacagcttcggccagagtgtacctggtcccctgaggaactcctcagactggaaa
gtgccgcaggatggagactatgagtttcttaagagttggacagtggaggaccttcagaag
aggctcctggccctcgaccccatgatggagcaagagattgaagagatccggcagaagtac
cagtccaagaggcagccaatcctggatgccattgaggctaagaagcggcggcaacaaaac
ttctga

DBGET integrated database retrieval system