KEGG   Ursus maritimus (polar bear): 103670054
Entry
103670054         CDS       T03271                                 

Gene name
PDGFA
Definition
(RefSeq) platelet derived growth factor subunit A
  KO
K04359  platelet-derived growth factor subunit A
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04072  Phospholipase D signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04510  Focal adhesion
umr04540  Gap junction
umr04630  JAK-STAT signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05206  MicroRNAs in cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05231  Choline metabolism in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103670054 (PDGFA)
   04014 Ras signaling pathway
    103670054 (PDGFA)
   04015 Rap1 signaling pathway
    103670054 (PDGFA)
   04630 JAK-STAT signaling pathway
    103670054 (PDGFA)
   04020 Calcium signaling pathway
    103670054 (PDGFA)
   04072 Phospholipase D signaling pathway
    103670054 (PDGFA)
   04151 PI3K-Akt signaling pathway
    103670054 (PDGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103670054 (PDGFA)
   04540 Gap junction
    103670054 (PDGFA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103670054 (PDGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103670054 (PDGFA)
   05202 Transcriptional misregulation in cancer
    103670054 (PDGFA)
   05206 MicroRNAs in cancer
    103670054 (PDGFA)
   05231 Choline metabolism in cancer
    103670054 (PDGFA)
  09162 Cancer: specific types
   05214 Glioma
    103670054 (PDGFA)
   05218 Melanoma
    103670054 (PDGFA)
   05215 Prostate cancer
    103670054 (PDGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103670054 (PDGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103670054 (PDGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103670054 (PDGFA)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103670054 (PDGFA)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103670054 (PDGFA)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103670054 (PDGFA)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 103670054
NCBI-ProteinID: XP_008696669
UniProt: A0A384CQA9
LinkDB
Position
Un
AA seq 241 aa
MGSSSGAYAAGGPGILHTPVCEPRDEYHRSNSASARRGAPETPEIARKHRLRGRPDIPAS
RQPSKAQQGCHAGGDPRGGFPEVGGRFLAVGSLSSSAHVGVAGLSGDPVCLGEAGRTHRW
TGPRTPHRCGPAGHRFLLLPVGAEDALEASLRAHGGHASKRAPEKRPMPIRRKRSIEEAI
PAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCAGCCNTSSVKCQPSRVHHPHTRK
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgggctccagttctggtgcctatgctgctgggggacccggcatccttcacactcctgtc
tgtgagcctcgggacgagtaccaccggagtaattccgcttctgcacgtcggggcgcgccg
gagacgcccgagatagcccggaagcaccggctccgggggcgaccggacatcccggccagt
cgccagcctagcaaagcacagcaggggtgccacgctgggggggacccccgtggaggcttc
cccgaggttggcgggagatttttggcagttgggagtctttcatcctctgcccacgtggga
gtggcgggcctctcaggggaccctgtctgtctgggggaggcaggtaggacgcaccgctgg
acaggccccaggacgccacacagatgcgggccagctggtcaccgtttcctcctcctgcct
gtaggggccgaggatgctttggaagcgagtctgagagcccacgggggccatgccagcaag
cgtgcacccgagaagaggcccatgcccatccgaaggaaaagaagcatcgaggaagccatc
ccggcggtctgcaagaccaggacggtcatttatgagatacctcggagccaggtcgacccc
acgtctgccaacttcctgatctggcccccgtgcgtggaggtgaagcgctgtgccgggtgc
tgtaacaccagcagcgtcaagtgccagccctcccgcgtccaccacccgcacaccaggaag
gcgtag

KEGG   Ursus maritimus (polar bear): 103676520
Entry
103676520         CDS       T03271                                 

Gene name
PDGFB
Definition
(RefSeq) platelet derived growth factor subunit B
  KO
K17386  platelet-derived growth factor subunit B
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04072  Phospholipase D signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04510  Focal adhesion
umr04540  Gap junction
umr04630  JAK-STAT signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05200  Pathways in cancer
umr05206  MicroRNAs in cancer
umr05211  Renal cell carcinoma
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05231  Choline metabolism in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103676520 (PDGFB)
   04014 Ras signaling pathway
    103676520 (PDGFB)
   04015 Rap1 signaling pathway
    103676520 (PDGFB)
   04630 JAK-STAT signaling pathway
    103676520 (PDGFB)
   04020 Calcium signaling pathway
    103676520 (PDGFB)
   04072 Phospholipase D signaling pathway
    103676520 (PDGFB)
   04151 PI3K-Akt signaling pathway
    103676520 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103676520 (PDGFB)
   04540 Gap junction
    103676520 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103676520 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103676520 (PDGFB)
   05206 MicroRNAs in cancer
    103676520 (PDGFB)
   05231 Choline metabolism in cancer
    103676520 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    103676520 (PDGFB)
   05218 Melanoma
    103676520 (PDGFB)
   05211 Renal cell carcinoma
    103676520 (PDGFB)
   05215 Prostate cancer
    103676520 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103676520 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103676520 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103676520 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103676520 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103676520 (PDGFB)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103676520 (PDGFB)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103676520 (PDGFB)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 103676520
NCBI-ProteinID: XP_008703950
UniProt: A0A384DB11
LinkDB
Position
Un
AA seq 332 aa
MSGYQGQTVETVRGDQIKVSYSQEPGDAVSLRVPWSSQELYPTRRLDASAQKGSDLPKVT
QLLSSQAGCEEAAKRESFTATPVSGCECRPRGCGFGLLAGDPIPEELYEMLSDHSIRSFD
DLQRLLHGASVDEDGAELDLNLTRSHSGGELESLSRGRRSLGEAADENGDPSMVGARQGE
LGYEKGRGQGPAIVWARASPLPAFGFRGKIPAGDTGVGRVGRRAPSAPACVVLQRHLDGS
VLQVRKIEIVRKKPTFKKATVTLEDHLACKCETVVAARPVTRSLGSTQEQRAKTPQTRVT
IRTVRVRRPPKGKHRKFKHTHDKKALKETLGA
NT seq 999 nt   +upstreamnt  +downstreamnt
atgtctgggtaccaagggcagacggtggagacagtgcgaggggaccagataaaggtgtcc
tacagccaggagcccggcgatgcagtgagcctgcgggtcccgtggtcctcccaagaactc
tatcccactcggaggctagatgcaagtgcacagaaaggaagtgacttgcccaaggtgacc
cagctcctcagcagccaggcaggatgcgaagaagctgcaaagcgtgagtccttcaccgct
acgcccgtgtcagggtgcgagtgccgccctcggggctgcgggtttggactcctggcgggg
gaccccattcccgaggagctctacgagatgctgagtgaccactcgatccgctcctttgat
gacctccagcgtctgctgcacggagcctccgtagacgaagacggggccgagctggacctg
aatttgacccgatcccattctggaggcgagctggagagcttatcccgagggagaaggagc
ctaggtgaggctgcagatgagaatggtgacccctccatggtgggagccagacaaggagaa
ctgggctacgagaagggcagagggcaaggtcctgctattgtttgggccagggcctctcca
ctcccggctttcggctttcgaggaaagatccctgcgggggacactggggtaggaagagta
ggcaggcgggctccctcagcccctgcctgtgtggtcttacagaggcacttggatggttct
gtccttcaggtgagaaaaatcgagattgtacggaagaagccaacctttaagaaggccacg
gtgaccctggaggaccacctggcgtgcaagtgtgagacagtggtggctgctcgacctgtg
acccgaagcctggggagtacccaggagcagcgagccaagacaccccaaactcgggtgacc
attcggacggtgcgagtccgccggccccccaaggggaagcaccggaagttcaagcacacg
catgacaagaaggcgctgaaggagaccctcggagcctag

DBGET integrated database retrieval system