KEGG   Ursus maritimus (polar bear): 103670120
Entry
103670120         CDS       T03271                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04060  Cytokine-cytokine receptor interaction
umr04066  HIF-1 signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04630  JAK-STAT signaling pathway
umr04640  Hematopoietic cell lineage
umr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103670120 (EPO)
   04066 HIF-1 signaling pathway
    103670120 (EPO)
   04151 PI3K-Akt signaling pathway
    103670120 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103670120 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103670120 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103670120 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103670120 (EPO)
Cytokines and growth factors [BR:umr04052]
 Cytokines
  CSF and other factors
   103670120 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 103670120
NCBI-ProteinID: XP_008696733
UniProt: A0A384CPK0
LinkDB
Position
Un
AA seq 234 aa
MNRLGKYSLNLDAYEWGSGAPRWGQRSGTCEPAPPXPTHSVWHSFLECPALLLLLSLLLL
PLGLPVLGAPPRLICDSRVLERYILEAREAENVTMGCAQGCSFSENITVPDTKVNFYTWK
RMDVGQQAVEVWQGLALLSEAILRGQALLANSSQLSETLRLHVDKAISSLRSLTSLLRAL
GAQKEAISLPEEASAAPLRTFTVDTLCKLFRIYSNFLRGKLTLYTGEACRRGDR
NT seq 705 nt   +upstreamnt  +downstreamnt
atgaaccgtttgggaaaatactcgctaaatctggatgcttacgagtgggggtcgggagcg
cctcgctgggggcagaggagcggaacgtgtgaaccggcccctccanaacccacacactca
gtctggcactcttttctagaatgtcctgccctgctgcttctgctgtccttgctgctgctt
cctctgggcctcccagtcctgggcgccccccctcgcctcatttgtgacagccgagtcctg
gagaggtacatcctggaggccagggaggccgaaaatgtcacgatgggctgtgctcaaggc
tgcagcttcagcgagaatatcaccgtcccagacaccaaggttaatttctacacctggaag
aggatggacgtcgggcagcaggccgtggaagtctggcagggcctggccctgctctcagaa
gccatcctgcggggccaggccctgttggccaactcctcgcagctgtctgagaccctgcgg
ttgcacgtggacaaagccatcagcagcctgcgcagcctcacctccctgcttcgggcgctg
ggagcccagaaggaggccatctcccttccagaggaagcctctgctgctccactccgaaca
ttcactgttgatactttgtgcaaacttttccgaatctactccaatttcctgcggggaaag
ctgacgctgtacacaggggaggcctgcaggagaggggacaggtga

DBGET integrated database retrieval system