KEGG   Ursus maritimus (polar bear): 103670171Help
Entry
103670171         CDS       T03271                                 

Gene name
WBSCR17
Definition
(RefSeq) Williams-Beuren syndrome chromosome region 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00512  Mucin type O-glycan biosynthesis
umr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    103670171 (WBSCR17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103670171 (WBSCR17)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     103670171 (WBSCR17)
Glycosyltransferases [BR:umr01003]
 O-Glycan biosynthesis
  Mucin-type
   103670171 (WBSCR17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 103670171
NCBI-ProteinID: XP_008696786
UniProt: A0A384CPN4
LinkDB All DBs
Position
Un
AA seq 549 aa AA seqDB search
MMKAYPNPLGSSKVMVGGAKGAFLLPFPRLKRRKPRDPMRSMATIPTSVKKFHWIVPFRI
IVPPSYSGSSLEDALEGGIGDEFGRLPMSHIRCKELKYAKELPQISIIFIFVNEALSVIL
RSVHSAVNHTPTHLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRA
RIEGWKVATGQVTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDTFEVQRYE
NSAHGYSWELWCMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDV
YGGENIELGIKVWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDY
KSHVYIAWNLPLENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGEL
RNNKAKDVCLDQGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVD
NSKSRLPQLLDCDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQ
RWTIKNSIK
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaggcttatccaaatcccttgggctcatcgaaggttatggtgggcggggcaaag
ggggccttcctgctaccctttccccggctgaagaggagaaagccaagggaccccatgaga
agtatggctacaattcctacctcagtgaaaaaatttcactggatcgttccattccggatt
atcgtcccaccaagttattctggaagctctctggaggatgcattggaaggtggaattgga
gatgaatttgggagattgcccatgagccatatacggtgcaaggagctgaagtacgccaag
gagctgccccagatctccatcatatttatcttcgtgaacgaggccctgtcggtgatcctg
cggtcagtccacagcgctgtcaaccacacgccaacacacctgctgaaggagatcatcctg
gtggacgacaacagtgatgaagaggagctgaaggcccccttggaggagtacgtccacaag
cgctaccctgggctggtgaaggtggtgcgcaatcaaaaaagagagggcctgatccgagct
cgcatcgagggctggaaggtggccacgggccaggtcactggcttctttgatgcccacgtg
gaattcaccgctggctgggccgagccggttctgtcccgaatccaggagaaccggaagcga
gtgatccttccatccatcgacaacatcaagcaggacacctttgaggtgcagcggtacgag
aactcggcccacggctacagctgggagttgtggtgcatgtacatcagccccccaaaagac
tggtgggacgccggagacccttctctccccatcaggacgccagccatgatcggctgctcc
ttcgtggtcaacaggaagttctttggtgaaatcggtcttcttgaccccgggatggatgtg
tatgggggagaaaatatcgaactcggaatcaaggtgtggctctgcgggggcagcatggag
gtcctgccttgctcacgagtggcccacatcgagcggaagaagaagccctacaacagcaac
attggcttctacaccaagaggaacgccctccgggttgcggaagtctggatggatgattac
aagtctcacgtgtacattgcgtggaacctgccgctggagaatccaggcattgacataggc
gatgtctccgaaagaagagccttgaggaagagtttaaagtgtaagaatttccagtggtac
ctggaccacgtgtacccggaaatgagaagatacaataacaccattgcatacggggagctt
cgaaacaacaaggcgaaagatgtctgcttggaccaggggccactggagaaccacacagca
atattgtacccatgccatggctggggaccccagcttgcccgctataccaaggagggcttc
ctgcacttgggcgccctggggaccaccacgctcctccccgacacccgctgcctggtggac
aactccaagagtcggctgccccagctcctcgactgtgacaaggtcaagagcagcttgtac
aagcgctggaacttcatccagaatggagccattatgaacaagggcacagggcgttgcctg
gaggtggagaaccggggcctggctggcattgacctcattctccgcagctgcacaggacag
aggtggacaattaagaactcgatcaagtag

DBGET integrated database retrieval system