KEGG   Ursus maritimus (polar bear): 103670197
Entry
103670197         CDS       T03271                                 

Gene name
PLOD3
Definition
(RefSeq) procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
  KO
K13646  lysyl hydroxylase/galactosyltransferase/glucosyltransferase [EC:1.14.11.4 2.4.1.50 2.4.1.66]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00310  Lysine degradation
umr00514  Other types of O-glycan biosynthesis
umr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103670197 (PLOD3)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    103670197 (PLOD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103670197 (PLOD3)
Enzymes [BR:umr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.4  procollagen-lysine 5-dioxygenase
     103670197 (PLOD3)
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     103670197 (PLOD3)
    2.4.1.66  procollagen glucosyltransferase
     103670197 (PLOD3)
Glycosyltransferases [BR:umr01003]
 O-Glycan biosynthesis
  O-linked Gal type
   103670197 (PLOD3)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3
Other DBs
NCBI-GeneID: 103670197
NCBI-ProteinID: XP_008696834
UniProt: A0A384CQS9
LinkDB
Position
Un
AA seq 651 aa
ITVATAETEGYRRFLRSAEFFNYTVRTLGLGEEWRGGDVARTVGGGQKVRWLKKEMEKYA
DREDMVIMFVDSYDVILLGSPSELLKKFVQSGSHLLFSAEGFCWPEWGLAEQYPEVGTGK
RFLNSGGFIGFAPTVHQVVRQWKYKDDDDDQLFYTRLYLDPGLREKLSLSLDHKSRIFQN
LNGALDEVVLKFDRNRVRIRNVAYDTLPVVVHGNGPTKLQLNYLGNYVPNGWGPQGGCGF
CGQDRRTLPGGQPDRVTLFLHNNEVYHEPHVADSWPQLQDHFSAVKLVGPEEALTPGEAR
DMAMDTCRQDPECEFYFSLDADAVITNQQTLRILIEENRKVIAPMLSRHGKLWSNFWGAL
SPDEYYARSEDYVELVQRKRVGVWNVPYISQAYVIRGETLRTELPQREVFSGSDTDPDMA
FCKSLRDKGIFLHLSNQHEFGRLLATSRYDTDHLHPDLWQIFDNPLDWKEQYIHENYSRA
LEGEGLVEQPCPDVYWFPLLSDQMCDELVEEMELYGQWSGGRHEDSRLAGGPTVDIHMKQ
VGYEDQWLQLLRTYVGPMTESLFPGYHTKTRAVMNFVVRYRPDEQPSLRPHHDSSTFTLN
VALNHKGLDYEVISSPRKGWGLLHPGRLTHYHEGLPTTRGTRYIMVSFVDP
NT seq 1956 nt   +upstreamnt  +downstreamnt
atcacggtggccacagccgagacggaaggataccggcgtttcctgcggtcagcggagttc
ttcaactacacagtgaggaccctgggcctgggagaggagtggcgagggggtgatgtggcc
cgaacggttggtggcggacagaaggtcaggtggctaaagaaggagatggagaaatatgcg
gaccgggaggatatggtcatcatgtttgtggacagctacgacgtgattctgcttggcagc
ccctcggagctgctgaagaagttcgttcagagtggaagccacctgctcttctctgcggag
ggcttctgctggcccgagtgggggctagcggagcagtaccctgaggtgggcacggggaag
cgcttcctcaactctggtggattcattggctttgcccccaccgtccaccaagttgtccgc
cagtggaagtacaaggatgacgatgacgaccagctgttctacacgcgactctacctggac
ccagggctgagggagaaactcagcctcagtctggatcataaatcccggatctttcagaac
ctcaatggggctttagatgaggtggttttaaagtttgatcggaatcgtgtgcgtatccgg
aatgtggcctatgacacgcttcccgtggtggttcatgggaacggtcccacgaagctccag
ctgaattacctgggaaactatgtccctaatggctgggggccccagggaggctgtgggttc
tgtggccaagaccggaggacactcccgggggggcagcccgacagggtcaccctgttcctg
cataacaatgaggtgtaccatgagccccacgttgcagactcctggccccagctccaggac
cacttttcagccgtgaagctggtggggccagaggaggccttgacgccaggcgaggccagg
gacatggccatggacacttgtcgacaggacccggagtgcgaattctacttcagcctggat
gccgacgccgtcatcaccaaccagcagaccctgcgcatcctcatcgaagagaacaggaag
gtgatagcgcccatgctgtcccgccacgggaagctgtggtccaacttctggggagccctg
agccctgacgagtactatgcccgctcggaggactacgtggagctggtacagcggaagcga
gtgggcgtgtggaatgtgccctatatatcccaggcatacgtgatccgtggcgagaccctg
aggacagagctgccccagagggaggtgttctcaggcagcgacacggacccggacatggcc
ttctgtaagagcctgcgggacaagggcatcttcctccacctgagcaatcagcacgaattc
ggccgcctcctggccacttcccgctatgacaccgaccatctgcaccctgacctctggcag
atcttcgacaaccccctggactggaaggagcagtacattcatgagaactacagccgggcc
ctagaaggggagggacttgtggagcagccgtgcccagacgtgtactggttcccactgctg
tccgaccagatgtgtgacgagctggtggaggaaatggagctctacggccagtggtcggga
ggccggcacgaggactcgaggctggccggagggcccaccgtggacatccacatgaagcag
gtgggctacgaggaccagtggctgcagctgctgaggacgtacgtgggccccatgacagag
agcctgttcccaggctaccacaccaagacccgggcagtgatgaacttcgtggtccgctac
cggccagacgagcagccctctctgcggccccatcacgactcgtccacctttactctcaac
gtggccctcaaccacaagggcctggattatgaggtgatctcgtctccgcggaagggctgg
gggctcctgcaccccggccgcctcacccactaccacgaggggctgcccactacccggggc
actcgctacatcatggtgtcctttgtcgacccctga

DBGET integrated database retrieval system