KEGG   Ursus maritimus (polar bear): 103670255
Entry
103670255         CDS       T03271                                 

Gene name
POMT1
Definition
(RefSeq) protein O-mannosyltransferase 1
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00514  Other types of O-glycan biosynthesis
umr00515  Mannose type O-glycan biosynthesis
umr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    103670255 (POMT1)
   00514 Other types of O-glycan biosynthesis
    103670255 (POMT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103670255 (POMT1)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     103670255 (POMT1)
Glycosyltransferases [BR:umr01003]
 O-Glycan biosynthesis
  O-linked Man type
   103670255 (POMT1)
SSDB
Motif
Pfam: PMT PMT_4TMC MIR
Other DBs
NCBI-GeneID: 103670255
NCBI-ProteinID: XP_008696904
UniProt: A0A384CQZ0
LinkDB
Position
Un
AA seq 724 aa
MLGFLKRPVVVTADINLNVVALTAVGLLSRLWQLAYPRAVVFDEVYYGQYISFYMKRIFF
LDGSGPPFGHMLLALGGYLGGFDGNFLWNRIGAEYSSNVPVWSLRLLPALTGALSVPMAY
QILLELGFSHCAAMGAALLMLIENALITQSRLMLLESVLIFFNLLAVLSYLKFSNSQKQR
PFSLSWWFWLMLTGVACSCAVGVKYVGVFTYLLVLAVASVHAWHLIGDRTLSHVRVLCHL
LARAAALLVVPALMYLLFFYVHLILVYRSGPHDQVMSSAFQASLEGGLARITQGQPLEVA
YGSQVTLKNVFGKPVPCWLHSHQSTYPMIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
RHQLVVGSPPRPVRHGDVGQLGHGMPTRFLNTHDVAAPLSPHSQEVSCYVDYNISMPSQN
LWRLDIVNRESDADVWKTILSEVRLVHVNTSVALKLSGAHLPDWGFRQLEVVGEKVSRGY
HESMVWNVEEHRYGKSQEQKERELELHSPAQMDVSRNLSFMARFLELQWRMLTVKSDGSE
HKYSSSPLDWVTLDTSIAYWLHPRNSAQIHLLGNVVIWASASLATVVYALLFLWYLLRRR
RSIRDLPEDSWLRWVLAGALCAGGWAVNYLPFFXXXXXXXXXXXXALTFQILLLPAVLQH
ISDHLCRSPPLRSLFSALVVAWYSCACHVFITLRPLTYGDKSLSPSELKALRWKDSWDIL
IRKY
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgttgggatttttgaagcgccctgtcgtggtgacagctgacatcaatttgaatgttgtg
gctctgaccgccgtggggctactgagccgcctgtggcagctcgcctatccaagggctgtg
gtttttgatgaagtgtattatgggcagtacatctctttctacatgaagcggatcttcttt
ctggatggcagtggaccaccgtttggccatatgctgctggccttaggaggttatttagga
ggattcgatggtaactttttgtggaacagaatcggagcagaatacagcagcaacgtgccc
gtgtggtctttgcgcctgctgccggccctgaccggggccctgtcggtgcccatggcctac
cagatcctgctggagctcggcttttctcattgcgccgccatgggggctgctctgctgatg
cttatcgagaatgctctcatcactcagtcaaggctcatgcttttggagtcagtgttaata
ttttttaatctgttggctgtgctgtcctacctgaagttctccaactcccaaaaacagagg
cccttctctctgagctggtggttttggctgatgctgacgggagtggcctgctcctgtgcc
gtgggtgtcaaatatgtgggtgttttcacgtacctgctggtgctcgcagtcgccagcgtc
catgcctggcacctgatcggagaccggactctgtcacacgtccgtgtgctctgtcacctg
cttgcccgagccgcagccctgctggtcgtcccggccctcatgtacttgctcttcttctat
gtccacttgattctggtctaccgctccgggccccacgatcaggtcatgtccagtgctttc
caagccagcctggagggagggctagctcggatcacgcagggccagcccctggaggtggcc
tatggttcccaggtcactctgaagaacgtcttcggcaaacccgtgccctgctggcttcat
tcccaccagagcacctaccccatgatatacgagaacggccgaggcagctcgcaccagcag
caggtgacctgttatcccttcaaagacgtcaacaactggtggatcgtgaaggatcccggg
aggcatcagctggtggtgggtagccccccgcggcccgtgcggcatggggacgtggggcag
ctgggacacggcatgcccacccgcttcctcaacacgcacgacgtggcggcgcccctgagc
ccgcactcgcaggaggtctcctgctacgtggattacaacatctccatgccctcccagaac
ctctggagactggacatcgtaaaccgggaatccgacgcggacgtttggaagaccatcttg
tcagaggtgcgcctggtgcacgtcaacacctccgtggccctcaagctgagcggggcccac
ctcccggactgggggttccggcagctggaggtcgtgggggagaaggtgtcccggggctac
cacgagagcatggtgtggaacgtggaggaacatcgatatggcaagagccaggagcagaag
gagagggagctggagctgcactcgcccgcgcagatggacgtcagcagaaacctgagcttc
atggccaggttcctggagctgcagtggaggatgctgacggtgaagagtgacggctcggag
cacaagtacagctcctcgccgctggactgggtcaccctggacaccagcatcgcctactgg
ctgcaccccaggaactctgctcagatccacctgctcgggaacgtcgtgatctgggcttcg
gccagcctcgccacggtggtctacgctctgctcttcctctggtacctgctgcgacgccga
aggagcatccgcgatctgcccgaggattcctggctgcgctgggtgctggccggggctctg
tgcgccggtggctgggcggtgaactacctccccttcttcnnannnnnnnnnnnnnnnnnn
nnnnnnnnnnnnncggcgctcaccttccagatcctcctgctccccgcggtcctgcagcac
atcagcgaccacctgtgcaggtccccgcccctgaggagcctcttcagcgccctggtcgtg
gcgtggtactcctgcgcctgtcacgtgttcatcacgctgcgcccgctcacctacggggac
aagtcgctctcgcccagcgaactcaaggcccttcgctggaaagacagctgggacatcctg
atccgaaaatactag

KEGG   Ursus maritimus (polar bear): 103674072
Entry
103674072         CDS       T03271                                 

Gene name
POMT2
Definition
(RefSeq) protein O-mannosyltransferase 2
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00514  Other types of O-glycan biosynthesis
umr00515  Mannose type O-glycan biosynthesis
umr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    103674072 (POMT2)
   00514 Other types of O-glycan biosynthesis
    103674072 (POMT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103674072 (POMT2)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     103674072 (POMT2)
Glycosyltransferases [BR:umr01003]
 O-Glycan biosynthesis
  O-linked Man type
   103674072 (POMT2)
SSDB
Motif
Pfam: PMT PMT_4TMC MIR
Other DBs
NCBI-GeneID: 103674072
NCBI-ProteinID: XP_008701160
UniProt: A0A384D343
LinkDB
Position
Un
AA seq 718 aa
MLLEVAFRQVQIPWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYLSGYDGTFLFQ
KPGDKYEHHNYMGMRGFCAFLGSLLVPFAYLIVLELSKSLPAALLTAALLTFDTGCLTLS
QYILLDPILMFFIMAAMLSMVKYNSCANRPFSAPWWFWLSLTGINLAGALGVKFVGLFII
LQVGWNTISDLWHLLGDLSLSVVTVGKHLTARILCLIVLPLTLYTATYAVHFRVLNKSGP
GDGFFSSAFQARLSGNNLHNASIPEHLAYGSVITVKNLRMAIGYLHSHRHLYPEGIGARQ
QQVSEPFVLSVLRQHQAVGWDGTRPSLSGPRPVPAPFFLLEQSSSCTLLLFPLANSSFFR
LQYPLDPSFPVEFVRHGDIIRLEHKETSRNLHSHYHEAPLTRKHYQVTGYGINGTGDSND
FWRIEVVNRRFGNRIRVLRSRIRLIHLVTGCVLGSSGKVLPKWGWEQLEVTCTPYLKETL
NSIWNVEDHINPKLPNISLDVLQPSFPEILLESHMVMIRGNNGLKPKDNEFTSKPWHWPI
NYQGLRFSGINDTDFRVYLLGNPVVWWLNLLSIALYLLLGSIIAVAVQRGARLPAEVEGL
SQVLLQGGGQLLLGWMLHYFPFFLMGRILYFHHYFPAMLFSSMLTGILWDTLLRLCAWSL
ASSSLARGVYVVGLLSLLLGTAYSFYLFHPLAYGMVGPLAQDPRSPMAGLKWLESWDF
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgttgctagaagttgctttccgccaggtgcagattccttgggatgagactcactttgga
aaaatgggaagctattatatcaaccgcacctttttctttgatgtgcacccacctctggga
aagatgctgataggtcttgctggctacctgagtgggtatgatgggacttttttgttccag
aagcctggggacaaatatgagcatcacaactacatgggaatgagaggattctgtgctttc
cttggttccttgctggtcccctttgcctacctcattgtattggagctgtccaagtctctc
cccgcagcactgctcactgctgccctcctcacctttgatacaggatgcctcactctgtcc
cagtatatcctccttgaccccatcttgatgttcttcatcatggctgccatgctgagcatg
gtcaagtacaactcctgtgccaacaggcccttctctgccccctggtggttctggctcagc
ctgactggcattaatctggctggtgctttaggggtcaagtttgttggcctctttatcatc
ctgcaagtggggtggaacaccatttcagacctttggcacctgcttggagacctcagtctt
tcagtggtgactgtggggaaacacctgaccgctcgcatcttatgcctcatagtgctgccg
ctgactctctacacggccacgtatgctgttcacttcagggtgctgaacaaaagtggtcct
ggcgatggcttcttcagttctgccttccaggcccggctttcaggcaacaaccttcacaat
gcttccatccccgaacatctggcctacggctccgtgatcaccgtgaagaacctgcggatg
gccatcggctatctccactcccacaggcacctctaccccgagggcattggtgcccggcag
cagcaggtcagcgagccttttgtactttctgtactgcggcaacaccaagctgttggctgg
gacggaacccgcccttctctttccggcccccgtcctgtacctgcgccgtttttcctcttg
gaacagtcttcctcctgcaccctcctcctctttcctctggctaactccagcttctttagg
ctgcagtatcccctggacccttccttcccagtagagtttgtaagacatggagacatcatt
cggctagaacacaaagagacttctcggaacctgcacagtcactatcatgaggcccccctg
acccggaagcactatcaggtcactggctatggcataaatgggacaggggactcaaatgat
ttctggcggattgaggttgtaaacagaagatttggaaaccggatcagagtgctaagaagt
cgcattcgcctcatccatctggtcacaggttgtgtcctgggctcctcgggaaaggtcttg
cctaagtggggctgggaacagttggaagttacttgcaccccatacctaaaggaaaccctc
aactctatctggaatgtggaggaccatatcaatcccaaattgccaaacatcagcctggat
gtgctgcagcccagttttcctgagatcttgctggagtcccacatggtgatgatccggggg
aacaatggcctcaaacccaaggacaatgagttcacatccaaaccctggcactggcctatc
aactatcagggcctgcgcttctcagggatcaatgatacagacttccgcgtgtatctgctc
ggcaacccggtggtttggtggctgaatctgttgagcattgccctctacctcctcttgggg
agcatcattgctgtcgctgtgcagagaggggcacgcctgcctgcggaggttgaagggctg
tcccaggtcctgttgcaaggaggcggtcagctcctgctcggctggatgctgcattacttc
ccattcttcctgatgggccggatcctctacttccaccactacttcccggccatgctcttc
tccagcatgttgacagggattctgtgggatactctcctgcggctctgtgcctggagtctg
gcctcctcttccctggccaggggcgtatatgtggtgggactcttgagcctgctcctggga
actgcctatagcttctacctcttccaccctctggcttacgggatggtgggtcccctagcc
caggacccccgaagtcccatggcgggactaaaatggctcgaatcatgggacttttga

DBGET integrated database retrieval system