KEGG   Ursus maritimus (polar bear): 103670658
Entry
103670658         CDS       T03271                                 

Gene name
ST6GAL2
Definition
(RefSeq) ST6 beta-galactoside alpha-2,6-sialyltransferase 2
  KO
K00779  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00510  N-Glycan biosynthesis
umr00514  Other types of O-glycan biosynthesis
umr01100  Metabolic pathways
Module
umr_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    103670658 (ST6GAL2)
   00514 Other types of O-glycan biosynthesis
    103670658 (ST6GAL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103670658 (ST6GAL2)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     103670658 (ST6GAL2)
Glycosyltransferases [BR:umr01003]
 Terminal extension
  Sialyltransferase
   103670658 (ST6GAL2)
SSDB
Motif
Pfam: Glyco_transf_29
Other DBs
NCBI-GeneID: 103670658
NCBI-ProteinID: XP_008697355
UniProt: A0A384CSC0
LinkDB
Position
Un
AA seq 386 aa
MKPHLKQWRQRMLCGIFAWGLLFVVIFVYFTDSNPAEPAPSSFSFLETRRLLPMQGKQRA
IMGAMQEPSLPESAGAHKGLLDGRPSGPFQKGPGDLPQWAQVRDGFENDEEFFSSQIGRK
SQSAFYPEDDDYFFAAGQPGFRSENFALMLFLNYVDLTAKIYSKFVTYVSLDSHDAVLRF
NSAPTRGYEKDVGNKTTVRIINSQILTNPNHHFIDSSLYKDVILVAWDPAPYSANLNLWY
KKPDYNLFTPYVQHRQRNPNQPFYILHPKFIWQLWDIIQENTKEKIQPNPPSSGFIGILI
MMSMCSEVHVYEYIPSIRQTELCHYHELYYDAACTLGAYHPLLYEKLLVQRLNTGAQGDL
HRKGKVVLPGLRAVRCPAPNPAGPPS
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgaaaccacacttgaagcaatggagacaaagaatgctttgcgggatattcgcctggggg
ctcctcttcgtggtgattttcgtttacttcaccgacagcaacccagccgagcctgcgccc
agctccttctccttcctggagaccaggaggctcctgcccatgcaggggaagcagagggcc
atcatgggtgccatgcaggagccctccttgcccgagagtgcgggtgcacacaaggggctg
ctggacggacgcccgtcgggccccttccagaaggggcccggcgacctgccacagtgggct
caggtgcgggacgggtttgaaaatgatgaagagttcttttcatcccagatcgggagaaaa
tcgcaaagtgctttctacccggaggacgacgactacttttttgccgccggtcagccaggc
ttcaggtctgaaaattttgctttgatgctttttctaaattatgttgatttgacagcaaaa
atatacagtaagtttgtcacttatgtgtccttagattctcatgatgcagttttgagattt
aactctgctcctacacgtggctacgagaaagatgttggaaataaaaccactgtccgcatc
attaattcccagattctgaccaaccccaatcaccacttcattgacagttcgttgtataaa
gatgtcattttagtggcctgggatcctgctccttattctgcaaatcttaatctgtggtac
aagaagccagattacaacctgttcactccatatgttcagcaccgtcagagaaacccaaat
cagccattttacattcttcatccaaaatttatatggcaactttgggacattatccaggag
aacaccaaggagaagattcagcccaacccgccatcttccggcttcattggaatcctcatc
atgatgtccatgtgcagcgaagtgcacgtgtatgaatacatcccgtccatccggcagacg
gagctgtgccactaccacgagctgtactacgacgcggcgtgcacgctcggcgcctaccac
ccgctgctctacgagaagctgctcgtgcagcggctgaacaccggcgcccagggcgacctg
caccgcaaggggaaggtggtcctgcccgggctccgggccgtgcgctgccccgcgcccaac
cccgccggtccgccctcttga

KEGG   Ursus maritimus (polar bear): 103670807
Entry
103670807         CDS       T03271                                 

Gene name
ST3GAL3
Definition
(RefSeq) ST3 beta-galactoside alpha-2,3-sialyltransferase 3
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00513  Various types of N-glycan biosynthesis
umr00514  Other types of O-glycan biosynthesis
umr00515  Mannose type O-glycan biosynthesis
umr00533  Glycosaminoglycan biosynthesis - keratan sulfate
umr00601  Glycosphingolipid biosynthesis - lacto and neolacto series
umr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    103670807 (ST3GAL3)
   00515 Mannose type O-glycan biosynthesis
    103670807 (ST3GAL3)
   00514 Other types of O-glycan biosynthesis
    103670807 (ST3GAL3)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    103670807 (ST3GAL3)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    103670807 (ST3GAL3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103670807 (ST3GAL3)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     103670807 (ST3GAL3)
Glycosyltransferases [BR:umr01003]
 Terminal extension
  Sialyltransferase
   103670807 (ST3GAL3)
SSDB
Motif
Pfam: Glyco_transf_29
Other DBs
NCBI-GeneID: 103670807
NCBI-ProteinID: XP_008697544
UniProt: A0A384CSS7
LinkDB
Position
Un
AA seq 374 aa
MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEDSNSVVLSFDSAGQTLGSEYDRLG
FLLKLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIR
EFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLSCRRCIIVGNGGVLANKSLGSRIDDY
DIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKY
IVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPT
LGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRK
LVKARVITDLTSGI
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgggactcttggtatttgtgcgcaatctgctgctagccctctgcctttttctggtactg
ggatttttgtattattctgcgtggaagctgcatttactccagtgggaggactccaattca
gtggttctttcctttgactccgctggacaaacactaggctcagagtatgatcggttgggt
ttcctcctgaagctggactctaaactgcctgctgagttagccaccaagtatgcaaacttt
tcagagggagcttgcaagcccggctatgcttcagccctgatgactgccatctttccccgg
ttctccaagccagcacccatgttcctggatgactctttccgcaagtgggctaggattcgg
gaatttgtgccgccttttgggatcaaaggtcaagacaatctaatcaaagccatcttgtca
gtcaccaaagagtaccgcctgacccctgccttggacagccttagctgtcgccgctgcatc
atcgtgggcaacggaggtgtccttgccaacaagtctctggggtcacggattgatgactat
gacattgtggtcaggctgaactcagcaccggtgaagggcttcgagaaggacgtgggcagc
aaaaccacactgcgcatcacctaccccgagggcgccatgcagcggcccgagcagtacgag
cgcgactctctgttcgtcctcgccggcttcaagtggcaggacttcaagtggttgaagtac
atcgtctacaaggagagagtgagtgcatcagacggcttctggaaatctgtggccacgcga
gtgcccaaggagccccctgagattcgcatcctcaacccatacttcatccaggaggccgcc
ttcaccctcatcggactgcccttcaacaatggcctcatgggccgtgggaacatcccgacc
cttggcagtgtggcagtgaccatggcactacacggctgtgacgaggtggcagtcgcgggc
tttggctacgacatgagcacgcccaacgcacccctacactactatgagaccgtgcgcatg
gcagccatcaaagagtcctggacgcacaatatccagcgagagaaagagtttctgaggaag
ctggtgaaagcacgtgtcatcactgacctaaccagcggcatctga

KEGG   Ursus maritimus (polar bear): 103676045
Entry
103676045         CDS       T03271                                 

Gene name
ST6GAL1
Definition
(RefSeq) ST6 beta-galactoside alpha-2,6-sialyltransferase 1
  KO
K00778  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00510  N-Glycan biosynthesis
umr00514  Other types of O-glycan biosynthesis
umr01100  Metabolic pathways
Module
umr_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    103676045 (ST6GAL1)
   00514 Other types of O-glycan biosynthesis
    103676045 (ST6GAL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103676045 (ST6GAL1)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     103676045 (ST6GAL1)
Glycosyltransferases [BR:umr01003]
 Terminal extension
  Sialyltransferase
   103676045 (ST6GAL1)
SSDB
Motif
Pfam: Glyco_transf_29
Other DBs
NCBI-GeneID: 103676045
NCBI-ProteinID: XP_008703400
UniProt: A0A384D8M5
LinkDB
Position
Un
AA seq 399 aa
MIHTNLKKKFSCCVLAFLLFAVICVWKEKKKGSYYDSLKLQTKEFQRLRGVEKQAATSSS
TQKPPRGNQALSSPRGPDKAKPEASFQVWNKDSSSKNLIPRLQKIWRNYLNMNKYKVSYK
GPGPGVKFSAEALHCHLRDHVNVSMVEATDFPFNTSEWEGFLPKENIRTKAGPWGRCAVV
SSAGSLKSSQLGREIDDHDAVLRFNGAPTASFQQDVGTKTTIRLMNSQLVTTEGRFLKDS
LYNEGILIVWDPSVYHSDIPKWYQSPDYSFFENYKSYRKLHPDQPFYILKPQMPWELWDI
IQEVSPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMG
AYHPLLFEKNLVKHLNQGTDEDIYLLGKATLPGFRKIRC
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgattcacaccaacctgaagaaaaagttcagctgctgtgtgctggcctttctcctgttt
gcagtcatctgtgtgtggaaggagaagaagaaaggcagttactatgattccctgaagttg
caaaccaaggaattccagcggttgagaggtgtggagaaacaggctgcgacttcaagcagc
acccagaagccccccaggggcaaccaggccctcagcagtccccggggcccagacaaagcc
aagccagaggcctccttccaggtgtggaacaaggacagctcttccaagaacctcatcccc
aggctgcagaagatctggaggaattatctgaatatgaacaagtacaaagtgtcctataag
gggccagggccaggtgtcaagttcagcgcagaggccctgcactgtcacctccgggaccac
gtgaacgtctccatggtggaggccacagattttcccttcaacacctccgaatgggagggt
ttcctgcccaaggagaacatcaggaccaaggctgggccatggggcaggtgtgctgttgtc
tcatcagccggatcactgaagtcctcccagctgggccgagaaatagatgatcatgacgca
gtcctgaggtttaatggggcgcccacagccagtttccaacaagatgtgggcacgaaaacc
accattcgcctgatgaactctcagttggtcaccactgaagggcgcttcctcaaagacagt
ctgtacaacgagggaatcctaattgtgtgggacccgtctgtttaccattcagatatccca
aagtggtaccagagccccgactacagcttcttcgagaactataagagctaccgcaagctg
catccagaccagcccttttacatcctcaagccccagatgccttgggagctgtgggacatc
attcaagaagtctccccagaggagattcagcccaaccctccatcctctgggatgcttggt
atcatcatcatgatgaccctgtgcgaccaggtggatatctacgagttcctcccgtccaag
cgcaagaccgacgtgtgctactactaccagaagttcttcgacagcgcctgcacgatgggc
gcctaccacccactcctctttgagaagaatctggtgaagcacctcaaccagggcacagac
gaggacatttacctgctggggaaagctacactgcctggcttccggaaaattcgctgctga

DBGET integrated database retrieval system