KEGG   Ursus maritimus (polar bear): 103670861
Entry
103670861         CDS       T03271                                 

Gene name
JUN
Definition
(RefSeq) Jun proto-oncogene, AP-1 transcription factor subunit
  KO
K04448  transcription factor AP-1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04024  cAMP signaling pathway
umr04137  Mitophagy - animal
umr04210  Apoptosis
umr04310  Wnt signaling pathway
umr04380  Osteoclast differentiation
umr04510  Focal adhesion
umr04530  Tight junction
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04657  IL-17 signaling pathway
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04668  TNF signaling pathway
umr04722  Neurotrophin signaling pathway
umr04912  GnRH signaling pathway
umr04915  Estrogen signaling pathway
umr04921  Oxytocin signaling pathway
umr04926  Relaxin signaling pathway
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr05030  Cocaine addiction
umr05031  Amphetamine addiction
umr05132  Salmonella infection
umr05133  Pertussis
umr05135  Yersinia infection
umr05140  Leishmaniasis
umr05142  Chagas disease
umr05161  Hepatitis B
umr05162  Measles
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05224  Breast cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05321  Inflammatory bowel disease
umr05323  Rheumatoid arthritis
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103670861 (JUN)
   04012 ErbB signaling pathway
    103670861 (JUN)
   04310 Wnt signaling pathway
    103670861 (JUN)
   04668 TNF signaling pathway
    103670861 (JUN)
   04024 cAMP signaling pathway
    103670861 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103670861 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    103670861 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103670861 (JUN)
   04530 Tight junction
    103670861 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103670861 (JUN)
   04621 NOD-like receptor signaling pathway
    103670861 (JUN)
   04625 C-type lectin receptor signaling pathway
    103670861 (JUN)
   04660 T cell receptor signaling pathway
    103670861 (JUN)
   04658 Th1 and Th2 cell differentiation
    103670861 (JUN)
   04659 Th17 cell differentiation
    103670861 (JUN)
   04657 IL-17 signaling pathway
    103670861 (JUN)
   04662 B cell receptor signaling pathway
    103670861 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103670861 (JUN)
   04915 Estrogen signaling pathway
    103670861 (JUN)
   04921 Oxytocin signaling pathway
    103670861 (JUN)
   04926 Relaxin signaling pathway
    103670861 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103670861 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103670861 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103670861 (JUN)
   05203 Viral carcinogenesis
    103670861 (JUN)
   05231 Choline metabolism in cancer
    103670861 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103670861 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103670861 (JUN)
   05211 Renal cell carcinoma
    103670861 (JUN)
   05224 Breast cancer
    103670861 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103670861 (JUN)
   05321 Inflammatory bowel disease
    103670861 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    103670861 (JUN)
   05031 Amphetamine addiction
    103670861 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103670861 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103670861 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103670861 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103670861 (JUN)
   05135 Yersinia infection
    103670861 (JUN)
   05133 Pertussis
    103670861 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103670861 (JUN)
   05170 Human immunodeficiency virus 1 infection
    103670861 (JUN)
   05161 Hepatitis B
    103670861 (JUN)
   05171 Coronavirus disease - COVID-19
    103670861 (JUN)
   05162 Measles
    103670861 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103670861 (JUN)
   05169 Epstein-Barr virus infection
    103670861 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    103670861 (JUN)
   05142 Chagas disease
    103670861 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103670861 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103670861 (JUN)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    103670861 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 ZapB PspA_IM30 FlaC_arch NBP1 Fib_alpha Spc29 Jnk-SapK_ap_N DUF3450 TMF_DNA_bd Seryl_tRNA_N
Other DBs
NCBI-GeneID: 103670861
NCBI-ProteinID: XP_008697602
UniProt: A0A384CRZ0
LinkDB
Position
Un
AA seq 240 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPALERLIIQSSNGHITTTPTPTQFLCPKNVRDEQEGFQQPPPPPHHL
PQQIPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRK
RKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 723 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tccgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactcggacctc
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgcgctggagcgcctgata
atccagtccagcaacgggcacatcaccactacgccgacccccacgcagttcctgtgcccc
aagaacgtgagagacgagcaggagggcttccagcagcccccgcccccgccgcaccacctg
ccccagcagatccccgtgcagcacccgcggcttcaggccttgaaggaggagccgcagacg
gtgcccgagatgcccggggaaacgccgcccctgtcccccatcgacatggagtcgcaggag
aggatcaaggcggagaggaagcgcatgaggaaccgcatagctgcctccaagtgccggaaa
aggaagctggagaggatcgccaggctggaggaaaaagtgaaaaccttgaaagcgcagaac
tcggagctggcgtccacggccaacatgctcagggaacaggtggcacagcttaaacagaaa
gtcatgaaccacgttaacagtgggtgccaactcatgctaacgcagcagttgcaaacgttt
tga

DBGET integrated database retrieval system