KEGG   Ursus maritimus (polar bear): 103670935
Entry
103670935         CDS       T03271                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04024  cAMP signaling pathway
umr04072  Phospholipase D signaling pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04540  Gap junction
umr04611  Platelet activation
umr04713  Circadian entrainment
umr04714  Thermogenesis
umr04724  Glutamatergic synapse
umr04726  Serotonergic synapse
umr04728  Dopaminergic synapse
umr04730  Long-term depression
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04913  Ovarian steroidogenesis
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04924  Renin secretion
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04961  Endocrine and other factor-regulated calcium reabsorption
umr04962  Vasopressin-regulated water reabsorption
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr04976  Bile secretion
umr05012  Parkinson disease
umr05030  Cocaine addiction
umr05031  Amphetamine addiction
umr05032  Morphine addiction
umr05034  Alcoholism
umr05142  Chagas disease
umr05146  Amoebiasis
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05200  Pathways in cancer
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103670935
   04020 Calcium signaling pathway
    103670935
   04072 Phospholipase D signaling pathway
    103670935
   04024 cAMP signaling pathway
    103670935
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103670935
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103670935
  09152 Endocrine system
   04911 Insulin secretion
    103670935
   04922 Glucagon signaling pathway
    103670935
   04923 Regulation of lipolysis in adipocytes
    103670935
   04912 GnRH signaling pathway
    103670935
   04913 Ovarian steroidogenesis
    103670935
   04915 Estrogen signaling pathway
    103670935
   04921 Oxytocin signaling pathway
    103670935
   04926 Relaxin signaling pathway
    103670935
   04935 Growth hormone synthesis, secretion and action
    103670935
   04918 Thyroid hormone synthesis
    103670935
   04928 Parathyroid hormone synthesis, secretion and action
    103670935
   04916 Melanogenesis
    103670935
   04924 Renin secretion
    103670935
   04925 Aldosterone synthesis and secretion
    103670935
   04927 Cortisol synthesis and secretion
    103670935
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103670935
   04270 Vascular smooth muscle contraction
    103670935
  09154 Digestive system
   04970 Salivary secretion
    103670935
   04971 Gastric acid secretion
    103670935
   04972 Pancreatic secretion
    103670935
   04976 Bile secretion
    103670935
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103670935
   04961 Endocrine and other factor-regulated calcium reabsorption
    103670935
  09156 Nervous system
   04724 Glutamatergic synapse
    103670935
   04728 Dopaminergic synapse
    103670935
   04726 Serotonergic synapse
    103670935
   04730 Long-term depression
    103670935
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103670935
  09159 Environmental adaptation
   04713 Circadian entrainment
    103670935
   04714 Thermogenesis
    103670935
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103670935
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103670935
  09165 Substance dependence
   05030 Cocaine addiction
    103670935
   05031 Amphetamine addiction
    103670935
   05032 Morphine addiction
    103670935
   05034 Alcoholism
    103670935
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103670935
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103670935
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103670935
   05165 Human papillomavirus infection
    103670935
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103670935
   05142 Chagas disease
    103670935
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103670935
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103670935
   04031 GTP-binding proteins [BR:umr04031]
    103670935
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103670935
  Exosomal proteins of other body fluids (saliva and urine)
   103670935
  Exosomal proteins of colorectal cancer cells
   103670935
  Exosomal proteins of bladder cancer cells
   103670935
GTP-binding proteins [BR:umr04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    103670935
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc GTP_EFTU
Other DBs
NCBI-GeneID: 103670935
NCBI-ProteinID: XP_008697670
UniProt: A0A384CT72
LinkDB
Position
Un
AA seq 335 aa
MRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVEL
ANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFL
DKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFN
DVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAE
KVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYC
YPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgaggatcctgcatgttaatgggtttaatggagagggcggcgaagaggacccgcaggct
gcaaggagcaacagcgatggtgagaaggcgaccaaagtgcaggacatcaaaaacaacctg
aaagaggcgatcgaaaccatcgtggccgccatgagcaacctggtgccgcccgtggagctg
gccaaccctgagaaccagttcagagtggactatattctgagcgtgatgaacgtaccggac
ttcgatttccctcccgagttctatgagcatgccaaggctctgtgggaggacgaaggagtg
cgtgcctgctacgagcgctccaacgagtaccagctgattgactgcgcccagtacttcctg
gacaagatcgatgtcatcaagcaggctgactatgtgcccagcgatcaggatctgcttcgc
tgccgcgtcctgacttctggaatctttgagaccaagttccaggtggacaaagtcaacttc
cacatgtttgacgtgggtggccagcgcgacgaacgccgcaaatggatccaatgcttcaac
gatgtgaccgccattatcttcgtggtggccagcagcagctacaacatggtcatccgggag
gacaaccagaccaaccgcctgcaggaggctctgaacctgttcaagagcatctggaacaac
agatggctgcgcaccatctccgtgatcctgttcctcaacaagcaagacctgctcgccgag
aaagtcctcgctggaaaatcgaagattgaggactactttccagagtttgctcgctacact
actcctgaggatgctaccccagagcccggagaggacccccgcgtgacccgggccaagtac
ttcatccgcgacgaatttctgagaatcagcactgctagtggggacggccgccactactgc
tacccccacttcacttgcgctgtggacaccgagaacattcgccgtgtgttcaacgactgc
cgtgacatcattcagcgcatgcaccttcgtcagtacgagctgctctaa

KEGG   Ursus maritimus (polar bear): 103670936
Entry
103670936         CDS       T03271                                 

Definition
(RefSeq) neuroendocrine secretory protein 55
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04024  cAMP signaling pathway
umr04072  Phospholipase D signaling pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04540  Gap junction
umr04611  Platelet activation
umr04713  Circadian entrainment
umr04714  Thermogenesis
umr04724  Glutamatergic synapse
umr04726  Serotonergic synapse
umr04728  Dopaminergic synapse
umr04730  Long-term depression
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04913  Ovarian steroidogenesis
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04924  Renin secretion
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04961  Endocrine and other factor-regulated calcium reabsorption
umr04962  Vasopressin-regulated water reabsorption
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr04976  Bile secretion
umr05012  Parkinson disease
umr05030  Cocaine addiction
umr05031  Amphetamine addiction
umr05032  Morphine addiction
umr05034  Alcoholism
umr05142  Chagas disease
umr05146  Amoebiasis
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05200  Pathways in cancer
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103670936
   04020 Calcium signaling pathway
    103670936
   04072 Phospholipase D signaling pathway
    103670936
   04024 cAMP signaling pathway
    103670936
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103670936
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103670936
  09152 Endocrine system
   04911 Insulin secretion
    103670936
   04922 Glucagon signaling pathway
    103670936
   04923 Regulation of lipolysis in adipocytes
    103670936
   04912 GnRH signaling pathway
    103670936
   04913 Ovarian steroidogenesis
    103670936
   04915 Estrogen signaling pathway
    103670936
   04921 Oxytocin signaling pathway
    103670936
   04926 Relaxin signaling pathway
    103670936
   04935 Growth hormone synthesis, secretion and action
    103670936
   04918 Thyroid hormone synthesis
    103670936
   04928 Parathyroid hormone synthesis, secretion and action
    103670936
   04916 Melanogenesis
    103670936
   04924 Renin secretion
    103670936
   04925 Aldosterone synthesis and secretion
    103670936
   04927 Cortisol synthesis and secretion
    103670936
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103670936
   04270 Vascular smooth muscle contraction
    103670936
  09154 Digestive system
   04970 Salivary secretion
    103670936
   04971 Gastric acid secretion
    103670936
   04972 Pancreatic secretion
    103670936
   04976 Bile secretion
    103670936
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103670936
   04961 Endocrine and other factor-regulated calcium reabsorption
    103670936
  09156 Nervous system
   04724 Glutamatergic synapse
    103670936
   04728 Dopaminergic synapse
    103670936
   04726 Serotonergic synapse
    103670936
   04730 Long-term depression
    103670936
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103670936
  09159 Environmental adaptation
   04713 Circadian entrainment
    103670936
   04714 Thermogenesis
    103670936
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103670936
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103670936
  09165 Substance dependence
   05030 Cocaine addiction
    103670936
   05031 Amphetamine addiction
    103670936
   05032 Morphine addiction
    103670936
   05034 Alcoholism
    103670936
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103670936
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103670936
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103670936
   05165 Human papillomavirus infection
    103670936
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103670936
   05142 Chagas disease
    103670936
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103670936
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103670936
   04031 GTP-binding proteins [BR:umr04031]
    103670936
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103670936
  Exosomal proteins of other body fluids (saliva and urine)
   103670936
  Exosomal proteins of colorectal cancer cells
   103670936
  Exosomal proteins of bladder cancer cells
   103670936
GTP-binding proteins [BR:umr04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    103670936
SSDB
Motif
Pfam: NESP55
Other DBs
NCBI-GeneID: 103670936
NCBI-ProteinID: XP_008697673
UniProt: A0A384CS92
LinkDB
Position
Un
AA seq 247 aa
MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQ
RRSFLNAHHRSAAQVFPEPPESDHEHEEGDLELSLPECLEYEEEFDYESETETETESEIE
SETDFETEPETAPATEPETEPEDERGPVVPKHTTFGQSLTERLHALRLRSPDASPSRAQP
STQEPQNTRQGEEPEPEDKDPRDPEESEEPKEEGKKQQRRCKPKKPTRRDPSPESPSKRG
PIPIRRH
NT seq 744 nt   +upstreamnt  +downstreamnt
atggatcgtaggtcccgggctcagcagtggcgccgagctcgccacaactacaacgatctg
tgcccacccatcggccgccgggcagccactgcgctcctctggctctcctgctccatcgcg
ctcctccgcgcccttgccacctccaacgcccgcgcccagcagcgcgcggccgcccagcag
cgccggagcttccttaacgcccaccaccgctccgccgcccaggtgttccctgagcccccc
gaatctgaccacgagcacgaggagggagaccttgagctgtccctccccgagtgcctagag
tacgaggaagagtttgactacgaatctgagaccgagaccgagaccgagtctgaaatcgaa
tccgagaccgacttcgagaccgagcctgagaccgcccccgccactgagcccgagaccgag
ccagaagacgagcgcggccccgtggtgcccaagcacaccaccttcggccaatctctcacg
gagcgtctgcacgctctgagattgcggagccccgacgcctccccaagtcgtgcgcagccc
agcactcaggagccccagaacaccagacagggggaggagcccgagcccgaggacaaggat
ccgagggaccccgaagagtctgaggagccaaaggaggaggggaagaagcagcagcgccgc
tgcaagccgaagaagcccacccgccgcgacccatccccggagtccccttccaaaaggggg
cccatccccatccggcgccactaa

DBGET integrated database retrieval system