KEGG   Ursus maritimus (polar bear): 103671011
Entry
103671011         CDS       T03271                                 

Gene name
FOS
Definition
(RefSeq) Fos proto-oncogene, AP-1 transcription factor subunit
  KO
K04379  proto-oncogene protein c-fos
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04024  cAMP signaling pathway
umr04210  Apoptosis
umr04380  Osteoclast differentiation
umr04620  Toll-like receptor signaling pathway
umr04657  IL-17 signaling pathway
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04668  TNF signaling pathway
umr04713  Circadian entrainment
umr04725  Cholinergic synapse
umr04728  Dopaminergic synapse
umr04915  Estrogen signaling pathway
umr04917  Prolactin signaling pathway
umr04921  Oxytocin signaling pathway
umr04926  Relaxin signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr04932  Non-alcoholic fatty liver disease
umr04935  Growth hormone synthesis, secretion and action
umr05031  Amphetamine addiction
umr05132  Salmonella infection
umr05133  Pertussis
umr05135  Yersinia infection
umr05140  Leishmaniasis
umr05142  Chagas disease
umr05161  Hepatitis B
umr05162  Measles
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05224  Breast cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05323  Rheumatoid arthritis
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103671011 (FOS)
   04668 TNF signaling pathway
    103671011 (FOS)
   04024 cAMP signaling pathway
    103671011 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103671011 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103671011 (FOS)
   04660 T cell receptor signaling pathway
    103671011 (FOS)
   04658 Th1 and Th2 cell differentiation
    103671011 (FOS)
   04659 Th17 cell differentiation
    103671011 (FOS)
   04657 IL-17 signaling pathway
    103671011 (FOS)
   04662 B cell receptor signaling pathway
    103671011 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103671011 (FOS)
   04917 Prolactin signaling pathway
    103671011 (FOS)
   04921 Oxytocin signaling pathway
    103671011 (FOS)
   04926 Relaxin signaling pathway
    103671011 (FOS)
   04935 Growth hormone synthesis, secretion and action
    103671011 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    103671011 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    103671011 (FOS)
   04728 Dopaminergic synapse
    103671011 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103671011 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103671011 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103671011 (FOS)
   05231 Choline metabolism in cancer
    103671011 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103671011 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103671011 (FOS)
   05224 Breast cancer
    103671011 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103671011 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    103671011 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103671011 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103671011 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103671011 (FOS)
   05135 Yersinia infection
    103671011 (FOS)
   05133 Pertussis
    103671011 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103671011 (FOS)
   05170 Human immunodeficiency virus 1 infection
    103671011 (FOS)
   05161 Hepatitis B
    103671011 (FOS)
   05171 Coronavirus disease - COVID-19
    103671011 (FOS)
   05162 Measles
    103671011 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103671011 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    103671011 (FOS)
   05142 Chagas disease
    103671011 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103671011 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103671011 (FOS)
   04131 Membrane trafficking [BR:umr04131]
    103671011 (FOS)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    103671011 (FOS)
Membrane trafficking [BR:umr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    103671011 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Other DBs
NCBI-GeneID: 103671011
NCBI-ProteinID: XP_008697788
UniProt: A0A384CSL4
LinkDB
Position
Un
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSTGAYSRAGVVKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT
LPLLSDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctctggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc
tccccggccggggacaatctctcctactaccactcaccggccgactccttctccagcatg
ggctctcccgtcaatgcacaggacttctgcacggatctggccgtctccagtgccaacttt
atcccgacggtgactgccatctccaccagcccggacctgcagtggttggtgcagcccacc
ctggtctcctccgtggccccatcccagaccagagccccccacccctatggagtccctacc
ccctccactggggcttactccagggctggagtcgtgaagaccatgacgggaggcagagct
cagagcattggcaggaggggcaaggtggaacagttgtccccagaagaagaagagaaaagg
agaatccgaagggaaaggaataagatggccgcagccaagtgccggaaccggaggagggag
ctgactgacactctccaagcggagacagaccaactagaagatgagaagtctgctttgcag
accgagattgccaacttgctgaaggagaaggaaaaactagagttcatcctggcggctcac
cgacctgcctgcaagatccccgacgacctgggcttccccgaagagatgtctgtggcttcc
ctagatctgagcgggggcctgcccgaagccgccacccccgagtccgaggaggctttcacc
ctgcccctcctcagtgatcctgagcccaagccctccgtggagcccgtcaagagcatcagc
agcatggagctgaaggccgagcccttcgatgacttcctgttcccagcgtcgtccaggccc
agcggctccgagaccgcccgctccgtgccagacatggacctgtctggttccttctatgca
gcggactgggagcccctgcatggtggctccctggggatggggcccatggccacagagctg
gagcctctgtgcacccccgtggtcacctgtactcccagctgcactacctacacgtcttcc
ttcgtcttcacctaccccgaggctgactccttccccagctgtgcggctgctcaccgcaag
ggcagcagcagcaacgaaccgtcctctgactcgctcagctcacccacgctgctggccctg
tga

DBGET integrated database retrieval system