Ursus maritimus (polar bear): 103671072 Help Entry 103671072         CDS       T03271                                  Gene name FADD Definition (RefSeq) Fas associated via death domain   KO K02373   FAS-associated death domain protein Organism umr  Ursus maritimus (polar bear) Pathway umr01524   Platinum drug resistance umr04210   Apoptosis umr04215   Apoptosis - multiple species umr04217   Necroptosis umr04620   Toll-like receptor signaling pathway umr04621   NOD-like receptor signaling pathway umr04622   RIG-I-like receptor signaling pathway umr04657   IL-17 signaling pathway umr04668   TNF signaling pathway umr05010   Alzheimer disease umr05022   Pathways of neurodegeneration - multiple diseases umr05132   Salmonella infection umr05142   Chagas disease umr05152   Tuberculosis umr05160   Hepatitis C umr05161   Hepatitis B umr05162   Measles umr05163   Human cytomegalovirus infection umr05164   Influenza A umr05165   Human papillomavirus infection umr05167   Kaposi sarcoma-associated herpesvirus infection umr05168   Herpes simplex virus 1 infection umr05169   Epstein-Barr virus infection umr05170   Human immunodeficiency virus 1 infection umr05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     103671072 (FADD)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     103671072 (FADD)    04215 Apoptosis - multiple species     103671072 (FADD)    04217 Necroptosis     103671072 (FADD)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103671072 (FADD)    04621 NOD-like receptor signaling pathway     103671072 (FADD)    04622 RIG-I-like receptor signaling pathway     103671072 (FADD)    04657 IL-17 signaling pathway     103671072 (FADD)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103671072 (FADD)   09164 Neurodegenerative disease    05010 Alzheimer disease     103671072 (FADD)    05022 Pathways of neurodegeneration - multiple diseases     103671072 (FADD)   09171 Infectious disease: bacterial    05132 Salmonella infection     103671072 (FADD)    05152 Tuberculosis     103671072 (FADD)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103671072 (FADD)    05161 Hepatitis B     103671072 (FADD)    05160 Hepatitis C     103671072 (FADD)    05164 Influenza A     103671072 (FADD)    05162 Measles     103671072 (FADD)    05168 Herpes simplex virus 1 infection     103671072 (FADD)    05163 Human cytomegalovirus infection     103671072 (FADD)    05167 Kaposi sarcoma-associated herpesvirus infection     103671072 (FADD)    05169 Epstein-Barr virus infection     103671072 (FADD)    05165 Human papillomavirus infection     103671072 (FADD)   09174 Infectious disease: parasitic    05142 Chagas disease     103671072 (FADD)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     103671072 (FADD) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Death tRNA_NucTran2_2 ZapA Motif Other DBs NCBI-GeneID:  103671072 NCBI-ProteinID:  XP_008697862 UniProt:  A0A384CSP3 LinkDB All DBs Position Un AA seq 147 aa AA seqDB search MWGYLSPNTLPRLLINHFLLSPDLRAAFDIICDNVGKDWRRLARHLKVTDAKIDAIEEKY PRNLTEQVRESLRVWKSTKTEEATVSHLVRVLRACQLNLVADLIVEHQQAQGLENENENE SSTGGGGSISVSLTSWDSDGPALGAPW NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgtggggttacttatctcctaacacgctccccagacttctgataaatcattttcttctc tccccagacctgcgtgcggcatttgacatcatctgtgataacgtggggaaggactggaga agactggcccgtcaccttaaagtgacagatgccaagatcgatgccatcgaggagaaatac ccccgcaacctgacagagcaggtgagggagtcactgagagtctggaagagcaccaagacg gaggaggcgacagtgtcccacctggtgagggtgctcagggcctgccagctgaacctggtg gccgacctcatcgtggagcatcagcaggcccagggcctcgaaaatgagaacgagaacgag agcagtacaggtggtggtggcagcatctccgtgtccttgacatcctgggactcggatggg cccgccttgggggccccctggtga

DBGET integrated database retrieval system