KEGG   Ursus maritimus (polar bear): 103671139
Entry
103671139         CDS       T03271                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04068  FoxO signaling pathway
umr04110  Cell cycle
umr04115  p53 signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04218  Cellular senescence
umr04310  Wnt signaling pathway
umr04340  Hedgehog signaling pathway
umr04371  Apelin signaling pathway
umr04390  Hippo signaling pathway
umr04510  Focal adhesion
umr04530  Tight junction
umr04630  JAK-STAT signaling pathway
umr04917  Prolactin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr04921  Oxytocin signaling pathway
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04934  Cushing syndrome
umr05160  Hepatitis C
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05216  Thyroid cancer
umr05218  Melanoma
umr05219  Bladder cancer
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103671139 (CCND1)
   04340 Hedgehog signaling pathway
    103671139 (CCND1)
   04390 Hippo signaling pathway
    103671139 (CCND1)
   04371 Apelin signaling pathway
    103671139 (CCND1)
   04630 JAK-STAT signaling pathway
    103671139 (CCND1)
   04068 FoxO signaling pathway
    103671139 (CCND1)
   04151 PI3K-Akt signaling pathway
    103671139 (CCND1)
   04152 AMPK signaling pathway
    103671139 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103671139 (CCND1)
   04115 p53 signaling pathway
    103671139 (CCND1)
   04218 Cellular senescence
    103671139 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103671139 (CCND1)
   04530 Tight junction
    103671139 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103671139 (CCND1)
   04921 Oxytocin signaling pathway
    103671139 (CCND1)
   04919 Thyroid hormone signaling pathway
    103671139 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103671139 (CCND1)
   05206 MicroRNAs in cancer
    103671139 (CCND1)
   05205 Proteoglycans in cancer
    103671139 (CCND1)
   05203 Viral carcinogenesis
    103671139 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103671139 (CCND1)
   05212 Pancreatic cancer
    103671139 (CCND1)
   05225 Hepatocellular carcinoma
    103671139 (CCND1)
   05226 Gastric cancer
    103671139 (CCND1)
   05214 Glioma
    103671139 (CCND1)
   05216 Thyroid cancer
    103671139 (CCND1)
   05221 Acute myeloid leukemia
    103671139 (CCND1)
   05220 Chronic myeloid leukemia
    103671139 (CCND1)
   05218 Melanoma
    103671139 (CCND1)
   05219 Bladder cancer
    103671139 (CCND1)
   05215 Prostate cancer
    103671139 (CCND1)
   05213 Endometrial cancer
    103671139 (CCND1)
   05224 Breast cancer
    103671139 (CCND1)
   05222 Small cell lung cancer
    103671139 (CCND1)
   05223 Non-small cell lung cancer
    103671139 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103671139 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103671139 (CCND1)
   04934 Cushing syndrome
    103671139 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103671139 (CCND1)
   05162 Measles
    103671139 (CCND1)
   05160 Hepatitis C
    103671139 (CCND1)
   05163 Human cytomegalovirus infection
    103671139 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103671139 (CCND1)
   05169 Epstein-Barr virus infection
    103671139 (CCND1)
   05165 Human papillomavirus infection
    103671139 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103671139 (CCND1)
SSDB
Motif
Pfam: Cyclin_C Cyclin_N
Other DBs
NCBI-GeneID: 103671139
NCBI-ProteinID: XP_008697935
UniProt: A0A384CTX9
LinkDB
Position
Un
AA seq 193 aa
MAHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVRGFGDGEAGGPRCLQGLPFQQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVA
EESRQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGSSNSFLSYHRLTR
FLSKVIKCDAVGE
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcacaccaactcttatgctgcgaagtggagaccatccgccgggcgtaccccgatgcc
aacctactcaacgaccgggtgctgcgggccatgctcaaggcggaggagacctgcgcaccc
tccgtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgtg
gccacctggatgctggaggtgcggggcttcggcgacggtgaagcgggcggcccgcgctgc
ttacaagggctcccgttccagcaaatggagctgctcctggtgaacaaactcaagtggaac
ctggccgcgatgaccccgcacgatttcattgagcacttcctctccaagatgccagtggcc
gaggagagcagacagatcatccggaagcatgctcagaccttcgtcgccctctgtgccaca
gacgtgaagttcatttccaacccgccctccatggtggcagccgggagtgtggtggccgcc
gtgcagggcctgcacctgggaagttccaacagcttcctgtcctaccaccgcctcactcgg
ttcctctccaaagtgattaagtgcgacgcggtaggcgagtaa

DBGET integrated database retrieval system