KEGG   Ursus maritimus (polar bear): 103671504
Entry
103671504         CDS       T03271                                 

Gene name
BCL2L11
Definition
(RefSeq) BCL2 like 11
  KO
K16341  Bcl-2-like protein 11
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04068  FoxO signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04210  Apoptosis
umr04215  Apoptosis - multiple species
umr04932  Non-alcoholic fatty liver disease
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103671504 (BCL2L11)
   04151 PI3K-Akt signaling pathway
    103671504 (BCL2L11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103671504 (BCL2L11)
   04215 Apoptosis - multiple species
    103671504 (BCL2L11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103671504 (BCL2L11)
   05206 MicroRNAs in cancer
    103671504 (BCL2L11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103671504 (BCL2L11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103671504 (BCL2L11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    103671504 (BCL2L11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103671504 (BCL2L11)
SSDB
Motif
Pfam: Bclx_interact Bim_N
Other DBs
NCBI-GeneID: 103671504
NCBI-ProteinID: XP_008698348
UniProt: A0A384CUA7
LinkDB
Position
Un
AA seq 207 aa
MLLLKTLKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGD
RCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKS
TQTPSPPCQAFNHYLSAMASMRQSQDVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNN
YQAAEAHPQMIILRLLRYIIRLVWRLQ
NT seq 624 nt   +upstreamnt  +downstreamnt
atgcttctcctaaaaactttaaaaaaagaccaaatggcaaagcaaccttcagatgtaagt
tctgagtgtgacagagaaggtggacaactgcagcctgctgagaggcctcctcagctcagg
cctggggcccctacctctctacagacagagcagcaaggtaatcctgaaggcgaaggggac
cgctgcccccaaggcagccctcagggcccgctggccccaccagccagcccaggccctttt
gctaccagatccccgcttttcatctttgtgagaagatcctccctgctgtctcgatcctcc
agtgggtatttctcttttgacacagacaggagcccggcacccatgagttgtgacaaatca
acacaaaccccaagtcctccttgccaggccttcaaccattatctcagtgcaatggcttcc
atgaggcagtctcaggatgtacctgccgatatgcgcccggagatatggattgcgcaagag
ttgcggcgtattggagacgaatttaatgcatattacccaaggagggtctttttgaataat
taccaagcagccgaagcccacccccaaatgattatcttgcgactgttacgttacatcatc
cgcctggtgtggagattgcagtga

DBGET integrated database retrieval system