KEGG   Ursus maritimus (polar bear): 103671767
Entry
103671767         CDS       T03271                                 

Gene name
MSH2
Definition
(RefSeq) mutS homolog 2
  KO
K08735  DNA mismatch repair protein MSH2
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01524  Platinum drug resistance
umr03430  Mismatch repair
umr05200  Pathways in cancer
umr05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    103671767 (MSH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103671767 (MSH2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103671767 (MSH2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103671767 (MSH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:umr03400]
    103671767 (MSH2)
DNA repair and recombination proteins [BR:umr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     103671767 (MSH2)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_IV MutS_II AAA_27 ArdA
Other DBs
NCBI-GeneID: 103671767
NCBI-ProteinID: XP_008698664
UniProt: A0A384CVY0
LinkDB
Position
Un
AA seq 938 aa
MWLVQSVQPEDTLQLESAAEVGFVRFFQAMPEKPTTTVRLFDRGDFYTAHHEDALLAARE
VFKTQGVVKYIGPAGTKTLESVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGSKASKEND
WYLAFKASPGNLSQFEDILFGNNDMSASIGVVGVKMSTVDGQRQVGVGYVDSIQRKLGLC
EFPDNDQFSNLEALLIQIGPKECVLPGGETAGDMGKLRQVIQRGGILITERKRADFFTKD
IYQDLNRLLKGKKGEPVNSAVLPEMENQVAASSLSAVIKFLELLSDDSNFGQFELTTFDF
SQYMKLDIAAVRALNLFQGSVEDTTGSQSLAALLNKCKTPQGQRLVNQWIKQPLMDKNRI
EERLNLVEAFVEDAELRQSLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPN
VIRALEKYEGKHQSLLLAVFVTPLIDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDP
NLSELREIMDDLEKKMQSTLVSAARDLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNN
KNFSTVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQDAIVKEIVNISSGYVEPMQTLN
DVLAQLDAVVSFAHVSNAAPVPYVRPVILEKGQGRITLKASRHACVEVQDEVAFIPNDVH
FEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGD
SQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGA
FCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANF
PRHVIECARQKALELEEFQYIGESQGYDDMEPAAKRCYLEREQGEKIIQEFLSKVKQVPF
TEMSEENITMKLKQLKAEVIAKNNSFVNEIISRIKVTT
NT seq 2817 nt   +upstreamnt  +downstreamnt
atgtggctagtacagagcgtgcagccggaggatacgctgcagctggagagcgcggccgag
gtcggcttcgtgcgcttcttccaggccatgccggagaagccgaccactacggtgcgcctc
ttcgaccggggcgacttctacacggcgcaccacgaggacgcgctgctggctgcccgagaa
gtgttcaagacgcagggggtagtcaagtacatagggccggcaggaacaaagactctggag
agtgttgtgcttagtaaaatgaattttgagtcttttgtaaaagatctgcttctagttcga
cagtatagagttgaagtttataagaatagagctggaagtaaggcctcaaaggagaatgat
tggtatttggcatttaaggcttctccaggtaatctttctcagtttgaagacattctgttt
ggtaacaatgatatgtcagcttccattggtgtcgtgggtgttaaaatgtctacagttgat
ggccaaagacaggtcggagttgggtatgttgactccatacagaggaagctaggactttgt
gagttcccggataatgatcagttctccaatttggaggctctcctgatacagattggacca
aaggaatgtgttttaccaggaggagagactgctggagacatgggaaaactgaggcaggtt
attcagagaggaggaattctgatcacagaaagaaaaagagctgacttttttacaaaagat
atttatcaggacctcaaccggttgttgaaaggcaaaaagggagagccggtgaatagtgct
gtcttgccagaaatggagaatcaggttgcagcttcatcactgtctgcagtaatcaagttt
ttagaactcttatcagatgattcaaattttggacagtttgaactgactacttttgacttc
agtcagtacatgaaattggatattgcagcagtcagagcccttaaccttttccagggttct
gttgaagatactactggctctcagtctctggctgcattgctgaataaatgcaaaacccct
caaggacaaagactggttaaccagtggattaagcagcctctcatggataagaacagaata
gaagagagactgaatttagtggaagcttttgtagaagatgcagaattgaggcagagttta
caagaagatttgcttcgtcgattcccagatcttaaccgacttgccaagaaatttcagaga
caagcagcaaatttacaagattgttatcgactctatcagggtataaatcaactccctaat
gttattcgggctctggaaaagtatgaaggaaaacaccagagtttattgttggcagttttt
gtcactcctcttattgatcttcgttctgatttctccaaatttcaggaaatgatagaaaca
actttagatatggatcaggtggaaaaccatgaattccttgtaaaaccttcatttgatccc
aatctgagtgaattaagagaaataatggatgacttggaaaagaagatgcagtcaacatta
gtaagtgcagcaagagatctaggtttggatcctggcaaacagattaaactggattccagt
gcacagtttggttattactttcgcgtaacatgtaaggaagaaaaagtccttcgtaacaat
aaaaacttcagtacggtggacattcagaagaatggtgttaaatttaccaacagtaaactg
acttctctcaatgaagagtataccaaaaataaaaccgagtacgaggaagcccaggatgcc
attgttaaagaaattgtcaatatttcttcaggctacgtagaaccgatgcagacgctcaat
gacgtgttagctcagctagatgctgttgtcagctttgcccacgtgtcaaatgcagcacct
gttccgtatgtgcgaccggtcattttggagaaaggacaaggaagaattacattgaaagca
tccagacacgcttgtgttgaagttcaagatgaagttgcatttattcctaatgatgttcac
ttcgaaaaagataaacagatgttccacatcattactggccccaatatgggaggtaaatcc
acatatattcgccaaactggggtgatagttctcatggcccagattgggtgttttgtgccg
tgtgagtcagcggaagtgtccattgtggactgcatcttggcccgcgtaggggctggtgac
agtcagttgaaaggagtctccacattcatggctgaaatgctagaaactgcttctattctc
aggtctgcaaccaaagattctttaataatcatagatgagttgggaagaggaacctctacc
tatgatggatttgggttagcgtgggctatatcagagtacattgcaacaaagattggtgct
ttttgcatgtttgcaacacattttcatgaacttactgccttggccaatcagataccaact
gttaataatctacatgtcacagcactaactactgaagagaccttaactatgctttatcag
gtgaagaaaggtgtctgtgatcagagtttcgggattcatgtcgcagagcttgccaatttc
cctaggcatgttatagagtgtgcgagacaaaaagctctggagctagaggagtttcaatat
attggagaatcacaaggatatgatgacatggaaccagccgcaaagaggtgctatctggaa
agagagcaaggtgaaaaaattattcaggagtttttatccaaggtgaagcaagtgcctttt
actgaaatgtcagaagaaaacatcacaatgaagttaaaacagctgaaagctgaggtaata
gcaaagaataatagttttgtaaatgaaatcatttcacgaatcaaagttactacatga

DBGET integrated database retrieval system