KEGG   Ursus maritimus (polar bear): 103671814
Entry
103671814         CDS       T03271                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04915  Estrogen signaling pathway
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05212  Pancreatic cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05223  Non-small cell lung cancer
umr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103671814 (TGFA)
   04012 ErbB signaling pathway
    103671814 (TGFA)
   04014 Ras signaling pathway
    103671814 (TGFA)
   04151 PI3K-Akt signaling pathway
    103671814 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103671814 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103671814 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103671814 (TGFA)
   05212 Pancreatic cancer
    103671814 (TGFA)
   05225 Hepatocellular carcinoma
    103671814 (TGFA)
   05214 Glioma
    103671814 (TGFA)
   05211 Renal cell carcinoma
    103671814 (TGFA)
   05215 Prostate cancer
    103671814 (TGFA)
   05223 Non-small cell lung cancer
    103671814 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103671814 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 103671814
NCBI-ProteinID: XP_008698700
UniProt: A0A384CW37
LinkDB
Position
Un
AA seq 174 aa
MEGRGLPSSPGSSLPSRLSPFLSSPHAGLLLAVCQALENSTSALSADPPVAAAVVSHFND
CPDSHSQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVV
SIVALAVLIIACVLIHCCQVRKHCEWCQALICRHEKPSALLKGRTACCHSETVV
NT seq 525 nt   +upstreamnt  +downstreamnt
atggaaggaaggggcctgccctcaagtcctggaagcagtttgccaagcagactctcacct
ttcctctcttctccccacgcaggtctcctgttggctgtgtgccaggccctggagaacagc
acgtccgctctgagtgcagacccgcctgtggccgcagctgtggtgtcccattttaatgac
tgcccagattcccacagtcagttctgcttccatggaacctgcaggtttttggtgcaggaa
gacaagccagcgtgcgtctgccattctgggtacgtgggcgcgcgctgtgagcatgccgac
ctcctggccgtggtggctgccagccagaagaagcaggccatcaccgccttggtggtggtc
tccatcgtggccctggccgtcctcatcatcgcgtgtgtgctgatacactgctgccaggtc
cgaaaacactgtgagtggtgccaggctctcatctgccggcacgagaagcccagtgccctg
ctgaagggaaggaccgcttgctgccactcagaaacagtggtctga

DBGET integrated database retrieval system