KEGG   Ursus maritimus (polar bear): 103672232Help
Entry
103672232         CDS       T03271                                 

Gene name
PCSK1
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
umr  Ursus maritimus (polar bear)
Brite
KEGG Orthology (KO) [BR:umr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:umr01002]
    103672232 (PCSK1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:umr03110]
    103672232 (PCSK1)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     103672232 (PCSK1)
Peptidases [BR:umr01002]
 Serine Peptidases
  Family S8: subtilisin family
   103672232 (PCSK1)
Chaperones and folding catalysts [BR:umr03110]
 Intramolecular chaperones
  Subtilisin family
   103672232 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein Proho_convert S8_pro-domain OmpA_membrane Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 103672232
NCBI-ProteinID: XP_008699127
LinkDB All DBs
Position
Un
AA seq 765 aa AA seqDB search
MERRAWTLQCTAFALFCAWCALNSVKAKRQFVNEWAAEIPGGPEAASAIAEELGYDLLGQ
IGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRSVLRDSALNL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYEN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
DNNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWTSVPEKEENHCQLNYYQPPVLR
FIPNSKMLRALKGNGEVIIEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSA
AGTSTVLLAERERDTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRMQNEGRIVNWK
LILHGTSSQPEHMKQPRVYTSYNTVQNDRRGVEKMVDPGEEEPTQENLKKNPLVSKSHSG
SSSEGRRDELVEAAPSEAMLRLLQSAFSKNSTPKQSPKKSPSAKLHIPYENFYEALEKLN
KPSQLKDSEDSLYNDYVDVFYNTKPYKHRDDRLLQALVDILREEN
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atggagagaagagcctggactctgcagtgtactgctttcgctctcttttgcgcttggtgt
gcactgaacagtgtaaaagcgaagaggcagtttgtgaatgaatgggcggcagaaatcccc
gggggaccggaggcagcttcggccatagcggaggagctgggctatgaccttctgggccag
attggatcacttgaaaatcattacttattcaaacataaaaaccatccccgaaggtctcga
aggagtgcctttcatattactaagagattatctgatgatgatcgtgtaatatgggctgaa
caacagtatgaaaaagagagaagtaaacgttcagttttaagagactcagcactaaatctc
ttcaatgatccaatgtggaatcagcagtggtacttgcaagatactaggatgactgcagcc
ctgcccaagctggatctccatgtgatacctgtttggcaaaaaggcatcacaggcaaagga
gttgttattacagtactggacgatggcttggagtggaatcacacagacatctatgaaaat
tatgatccagaggctagttatgattttaacgataatgaccatgatccatttccccgttat
gatcccacaaatgagaacaaacatgggaccagatgtgcaggagaaattgccatgcaagca
aataatcacaagtgtggggtcggagttgcatacaattccaaagttggaggcataagaatg
ctggatggcattgtgacagatgctattgaagccagctcaattggattcaatcccggacat
gtggacatttacagtgccagctggggccctaatgatgacggcaaaactgtggaggggcct
ggccgactggcccagaaggcttttgaatatggtgtcaagcaggggagacaaggaaagggc
tccatcttcgtgtgggcttctgggaacggggggcgtcagggcgataactgtgactgtgac
ggctacacggacagcatctacaccatctccatcagcagcgcctcacagcaaggcttgtcc
ccctggtacgctgagaagtgctcctccaccctggccacctcgtacagcagcggggattac
acggaccagcgaatcacaagcgccgacctgcacaatgactgcacagagacccacacgggc
acctcggcctcggcacccctggctgctggcatcttcgctctggcgctggaagcaaatcca
aatctcacttggcgagacatgcaacacttggttgtctggacctctgagtatgacccactg
gacaataaccctggatggaaaaagaatggagcaggcttgatggtgaatagtcgatttgga
tttgggttgctaaatgccaaagctctggtggatttagctgatcccaggacctggaccagt
gtgcctgagaaggaagaaaatcactgccaattaaactattaccaaccaccagttttaaga
ttcatcccaaattcaaagatgttaagagccctgaaaggtaatggagaagttatcattgaa
attccaacaagagcttgtgaaggacaagaaaacgccatcaagtccctggaacatgtgcaa
tttgaagcaacgattgaatattcccgaagaggagaccttcatgttacactcacttctgct
gctgggaccagcactgtactgttggctgaaagagagcgggatacatctcctaacggcttt
aagaattgggacttcatgtctgttcacacgtggggagagaatcccataggcacttggact
ttgcgaattacagacatgtctggaagaatgcaaaatgaaggaagaattgtcaactggaag
ctgattttgcatgggacctcgtctcagccagaacacatgaaacagcctcgtgtgtacacg
tcctataacaccgttcagaatgacagaagaggggtggagaagatggtggatccgggggag
gaggagcccacacaagagaacctgaaaaagaacccccttgtgtcaaaaagtcacagtggc
agcagttcagagggcagaagggatgagctggtggaggcagccccatcagaggctatgctg
agactcctacaaagtgctttcagcaaaaactcaaccccaaagcaatcaccaaagaagtct
ccaagtgcaaagctccacatcccttatgaaaatttctatgaagccctggaaaagctgaac
aagccttcccagcttaaagactctgaggacagtctatacaacgactatgttgatgttttc
tataacacgaaaccttacaagcacagagatgaccggctgctgcaggctctggtggacatt
ctgagggaagaaaattga

DBGET integrated database retrieval system